Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   AAHT66_RS11415 Genome accession   NZ_CP154441
Coordinates   2200888..2201298 (+) Length   136 a.a.
NCBI ID   WP_148962112.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain XN303     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2174742..2199942 2200888..2201298 flank 946


Gene organization within MGE regions


Location: 2174742..2201298
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT66_RS11260 (AAHT66_11260) - 2174742..2175098 (+) 357 WP_242519850.1 hypothetical protein -
  AAHT66_RS11265 (AAHT66_11265) - 2175898..2176275 (-) 378 Protein_2159 glycosyltransferase -
  AAHT66_RS11270 (AAHT66_11270) - 2176621..2177484 (-) 864 WP_202327717.1 ferritin family protein -
  AAHT66_RS11275 (AAHT66_11275) - 2177685..2178210 (+) 526 Protein_2161 DUF421 domain-containing protein -
  AAHT66_RS11280 (AAHT66_11280) - 2178346..2178612 (-) 267 WP_087993855.1 transcriptional regulator -
  AAHT66_RS11285 (AAHT66_11285) - 2178869..2179317 (+) 449 Protein_2163 ArpU family phage packaging/lysis transcriptional regulator -
  AAHT66_RS11290 (AAHT66_11290) - 2179585..2179728 (-) 144 WP_333516579.1 helix-turn-helix domain-containing protein -
  AAHT66_RS11295 (AAHT66_11295) - 2179837..2180394 (-) 558 WP_202327121.1 GNAT family N-acetyltransferase -
  AAHT66_RS11300 (AAHT66_11300) - 2180926..2182122 (-) 1197 WP_253268437.1 DUF418 domain-containing protein -
  AAHT66_RS11305 (AAHT66_11305) yrkP 2182390..2183085 (+) 696 WP_253268436.1 two-component response regulator YrkP -
  AAHT66_RS11310 (AAHT66_11310) yrkQ 2183072..2184370 (+) 1299 WP_253268435.1 two-component system sensor histidine kinase YrkQ -
  AAHT66_RS11315 (AAHT66_11315) psiE 2184416..2184832 (+) 417 WP_253268434.1 phosphate-starvation-inducible protein PsiE -
  AAHT66_RS11320 (AAHT66_11320) - 2185721..2185971 (+) 251 Protein_2170 IS3 family transposase -
  AAHT66_RS11325 (AAHT66_11325) - 2186038..2186325 (-) 288 WP_087993861.1 hypothetical protein -
  AAHT66_RS11330 (AAHT66_11330) - 2186339..2188264 (-) 1926 WP_333516578.1 ribonuclease YeeF family protein -
  AAHT66_RS11335 (AAHT66_11335) - 2188633..2188792 (-) 160 Protein_2173 hypothetical protein -
  AAHT66_RS11340 (AAHT66_11340) phrE 2188902..2189036 (-) 135 WP_014114495.1 phosphatase RapE inhibitor PhrE -
  AAHT66_RS11345 (AAHT66_11345) rapE 2189026..2190153 (-) 1128 WP_087993863.1 response regulator aspartate phosphatase RapE -
  AAHT66_RS11350 (AAHT66_11350) - 2190680..2190801 (+) 122 Protein_2176 TetR family transcriptional regulator -
  AAHT66_RS11355 (AAHT66_11355) - 2190930..2191232 (+) 303 Protein_2177 zinc-binding dehydrogenase -
  AAHT66_RS11360 (AAHT66_11360) - 2191240..2192247 (+) 1008 WP_253268432.1 NADP-dependent oxidoreductase -
  AAHT66_RS11365 (AAHT66_11365) - 2192475..2192614 (+) 140 Protein_2179 tryptophan--tRNA ligase -
  AAHT66_RS11370 (AAHT66_11370) - 2192832..2193407 (+) 576 WP_087993865.1 TetR/AcrR family transcriptional regulator -
  AAHT66_RS11375 (AAHT66_11375) - 2193519..2194367 (+) 849 WP_087990796.1 alpha/beta fold hydrolase -
  AAHT66_RS11380 (AAHT66_11380) - 2194382..2195440 (+) 1059 WP_087990795.1 alkene reductase -
  AAHT66_RS11385 (AAHT66_11385) - 2195777..2196562 (+) 786 WP_087990794.1 SDR family NAD(P)-dependent oxidoreductase -
  AAHT66_RS11390 (AAHT66_11390) - 2196922..2197671 (+) 750 WP_087990793.1 SDR family NAD(P)-dependent oxidoreductase -
  AAHT66_RS11395 (AAHT66_11395) - 2198135..2199148 (+) 1014 WP_087990821.1 NADP-dependent oxidoreductase -
  AAHT66_RS11400 (AAHT66_11400) - 2199600..2199778 (+) 179 Protein_2186 hypothetical protein -
  AAHT66_RS11405 (AAHT66_11405) - 2199736..2199840 (+) 105 Protein_2187 recombinase -
  AAHT66_RS11410 (AAHT66_11410) sigK 2199961..2200689 (-) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  AAHT66_RS11415 (AAHT66_11415) nucA/comI 2200888..2201298 (+) 411 WP_148962112.1 sporulation-specific Dnase NucB Machinery gene

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14952.96 Da        Isoelectric Point: 5.1750

>NTDB_id=993354 AAHT66_RS11415 WP_148962112.1 2200888..2201298(+) (nucA/comI) [Bacillus inaquosorum strain XN303]
MKKWMAGLFLAAAVLLCFMVPQQIQGASLYDKVLTFPLSRYPETGDHIRDAIAEGHSDICTIDRDGADKRRQESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSGYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=993354 AAHT66_RS11415 WP_148962112.1 2200888..2201298(+) (nucA/comI) [Bacillus inaquosorum strain XN303]
ATGAAAAAGTGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTTATGGTTCCGCAGCAGATCCAAGGCGC
TTCTTTGTATGACAAAGTGTTGACTTTTCCGCTGTCTCGTTATCCGGAAACAGGGGATCATATTAGAGATGCGATTGCAG
AGGGACATTCTGATATTTGCACCATCGATAGGGATGGTGCGGACAAAAGGCGGCAGGAATCATTAAAAGGAATTCCGACG
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTTTGTGAGGAGGGCGGCGCGGGGGCAGATGTCCGATATGTCAC
GCCTTCTGATAATCGCGGGGCCGGCTCATGGGTAGGGAATCAAATGAGCGGTTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(39-127)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

61.345

87.5

0.537

Multiple sequence alignment