Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AT689_RS11010 Genome accession   NZ_LN831051
Coordinates   2081128..2081277 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain NCTC7465     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 2076128..2086277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AT689_RS10970 (ERS445053_02146) ccrZ 2076320..2077114 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  AT689_RS10975 (ERS445053_02147) - 2077275..2077886 (-) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  AT689_RS10980 (ERS445053_02148) blpZ 2078037..2078271 (-) 235 Protein_2080 immunity protein BlpZ -
  AT689_RS10985 (ERS445053_02149) - 2078313..2079002 (-) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  AT689_RS10990 (ERS445053_02150) - 2079054..2079437 (-) 384 WP_000877381.1 hypothetical protein -
  AT689_RS11000 (ERS445053_02151) - 2080066..2080424 (-) 359 Protein_2083 immunity protein -
  AT689_RS11005 - 2080905..2081024 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AT689_RS11010 cipB 2081128..2081277 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  AT689_RS11015 (ERS445053_02153) blpN 2081521..2081724 (-) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  AT689_RS11020 (ERS445053_02154) blpM 2081740..2081994 (-) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  AT689_RS11025 (ERS445053_02155) comA/nlmT 2082276..2084429 (+) 2154 WP_000205159.1 peptide cleavage/export ABC transporter BlpA Regulator
  AT689_RS11030 (ERS445053_02156) - 2084440..2085801 (+) 1362 WP_001069064.1 bacteriocin secretion accessory protein -
  AT689_RS11035 (ERS445053_02157) blpC 2085858..2086013 (+) 156 WP_000358812.1 quorum-sensing system pheromone BlpC -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=991835 AT689_RS11010 WP_001809846.1 2081128..2081277(-) (cipB) [Streptococcus pneumoniae strain NCTC7465]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=991835 AT689_RS11010 WP_001809846.1 2081128..2081277(-) (cipB) [Streptococcus pneumoniae strain NCTC7465]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531