Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MWH27_RS12755 Genome accession   NZ_JALJVV010000001
Coordinates   2369751..2369924 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain A-5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2364751..2374924
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MWH27_RS12740 (MWH27_12715) gcvT 2365550..2366638 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  MWH27_RS12745 (MWH27_12720) hepAA 2367080..2368753 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  MWH27_RS12750 (MWH27_12725) yqhG 2368774..2369568 (+) 795 WP_014480249.1 YqhG family protein -
  MWH27_RS12755 (MWH27_12730) sinI 2369751..2369924 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MWH27_RS12760 (MWH27_12735) sinR 2369958..2370293 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MWH27_RS12765 (MWH27_12740) tasA 2370386..2371171 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  MWH27_RS12770 (MWH27_12745) sipW 2371235..2371807 (-) 573 WP_003230181.1 signal peptidase I SipW -
  MWH27_RS12775 (MWH27_12750) tapA 2371791..2372552 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  MWH27_RS12780 (MWH27_12755) yqzG 2372824..2373150 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MWH27_RS12785 (MWH27_12760) spoIITA 2373192..2373371 (-) 180 WP_014480252.1 YqzE family protein -
  MWH27_RS12790 (MWH27_12765) comGG 2373442..2373816 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MWH27_RS12795 (MWH27_12770) comGF 2373817..2374200 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  MWH27_RS12800 (MWH27_12775) comGE 2374226..2374573 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=990399 MWH27_RS12755 WP_003230187.1 2369751..2369924(+) (sinI) [Bacillus subtilis strain A-5]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=990399 MWH27_RS12755 WP_003230187.1 2369751..2369924(+) (sinI) [Bacillus subtilis strain A-5]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1