Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   HMPREF9425_RS09215 Genome accession   NZ_GL831112
Coordinates   309078..309209 (+) Length   43 a.a.
NCBI ID   WP_003093551.1    Uniprot ID   A0ABP2KKS5
Organism   Streptococcus vestibularis ATCC 49124     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 304078..314209
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HMPREF9425_RS01575 (HMPREF9425_0330) - 304964..306709 (+) 1746 WP_003096136.1 ABC transporter ATP-binding protein -
  HMPREF9425_RS01580 (HMPREF9425_0331) - 306870..307049 (+) 180 WP_003096139.1 Blp family class II bacteriocin -
  HMPREF9425_RS09875 (HMPREF9425_0332) - 307065..307232 (+) 168 WP_003096142.1 hypothetical protein -
  HMPREF9425_RS09665 - 307372..307461 (+) 90 WP_022495887.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  HMPREF9425_RS10630 (HMPREF9425_0337) - 308429..308830 (+) 402 WP_003096161.1 hypothetical protein -
  HMPREF9425_RS09215 (HMPREF9425_0338) cipB 309078..309209 (+) 132 WP_003093551.1 Blp family class II bacteriocin Regulator
  HMPREF9425_RS01610 (HMPREF9425_0339) - 309410..309637 (+) 228 WP_003094508.1 hypothetical protein -
  HMPREF9425_RS01615 (HMPREF9425_0340) - 309649..310041 (+) 393 WP_003094909.1 hypothetical protein -
  HMPREF9425_RS01620 (HMPREF9425_0341) - 310512..310730 (+) 219 WP_003096164.1 Blp family class II bacteriocin -
  HMPREF9425_RS01625 (HMPREF9425_0342) - 310763..310990 (+) 228 WP_003096166.1 bacteriocin class II family protein -
  HMPREF9425_RS01630 (HMPREF9425_0343) - 311040..311453 (+) 414 WP_003096168.1 hypothetical protein -
  HMPREF9425_RS01635 (HMPREF9425_0344) - 311566..311745 (+) 180 WP_003096170.1 hypothetical protein -
  HMPREF9425_RS01640 (HMPREF9425_0345) - 311932..312858 (+) 927 WP_037621304.1 thioredoxin family protein -
  HMPREF9425_RS01645 - 313023..313319 (+) 297 Protein_330 bacteriocin immunity protein -

Sequence

Protein


Download         Length: 43 a.a.        Molecular weight: 4512.96 Da        Isoelectric Point: 3.7781

>NTDB_id=989559 HMPREF9425_RS09215 WP_003093551.1 309078..309209(+) (cipB) [Streptococcus vestibularis ATCC 49124]
MATQTIENFNTLDLETLASVEGGGCSWRGAGGTVAYGATCWWS

Nucleotide


Download         Length: 132 bp        

>NTDB_id=989559 HMPREF9425_RS09215 WP_003093551.1 309078..309209(+) (cipB) [Streptococcus vestibularis ATCC 49124]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTTGACCTCGAAACACTTGCTAGTGTTGAAGGAGGTGGATGTAGTTG
GAGAGGCGCAGGTGGTACTGTTGCCTATGGAGCAACCTGCTGGTGGAGCTAA

Domains

Predicted by InterProScan.

COMC family (ComC)

(1-26)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.632

88.372

0.465