Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8570_RS02390 Genome accession   NZ_AP026932
Coordinates   479066..479215 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain PZ900701549     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 477342..478147 479066..479215 flank 919


Gene organization within MGE regions


Location: 477342..479215
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8570_RS02375 - 477342..478147 (+) 806 Protein_466 IS5 family transposase -
  R8570_RS02380 (PC1528_04740) blpM 478349..478603 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  R8570_RS02385 (PC1528_04750) blpN 478619..478822 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R8570_RS02390 (PC1528_04760) cipB 479066..479215 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=98882 R8570_RS02390 WP_001813641.1 479066..479215(+) (cipB) [Streptococcus pneumoniae strain PZ900701549]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=98882 R8570_RS02390 WP_001813641.1 479066..479215(+) (cipB) [Streptococcus pneumoniae strain PZ900701549]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment