Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   AAC934_RS13230 Genome accession   NZ_CP152362
Coordinates   2571638..2572048 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain LP     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2567004..2593039 2571638..2572048 within 0


Gene organization within MGE regions


Location: 2567004..2593039
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAC934_RS13205 (AAC934_13205) yqeF 2567171..2567902 (-) 732 WP_029726702.1 SGNH/GDSL hydrolase family protein -
  AAC934_RS13210 (AAC934_13210) cwlH 2568154..2568906 (-) 753 WP_029726701.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  AAC934_RS13215 (AAC934_13215) yqeD 2569093..2569719 (+) 627 WP_038427798.1 TVP38/TMEM64 family protein -
  AAC934_RS13220 (AAC934_13220) gnd 2569738..2570631 (-) 894 WP_038429331.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  AAC934_RS13225 (AAC934_13225) yqeB 2570883..2571605 (+) 723 WP_342623042.1 DUF308 domain-containing protein -
  AAC934_RS13230 (AAC934_13230) nucA/comI 2571638..2572048 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  AAC934_RS13235 (AAC934_13235) - 2572244..2572588 (+) 345 Protein_2570 sigma-70 family RNA polymerase sigma factor -
  AAC934_RS13240 (AAC934_13240) - 2572734..2573204 (+) 471 WP_069322767.1 MarR family transcriptional regulator -
  AAC934_RS13245 (AAC934_13245) - 2573354..2574766 (+) 1413 WP_342623047.1 MDR family MFS transporter -
  AAC934_RS13250 (AAC934_13250) spoIVCA 2574953..2576413 (-) 1461 WP_342625727.1 site-specific DNA recombinase SpoIVCA -
  AAC934_RS13255 (AAC934_13255) - 2576371..2576549 (-) 179 Protein_2574 hypothetical protein -
  AAC934_RS13260 (AAC934_13260) - 2577160..2579025 (+) 1866 WP_167408301.1 DUF4365 domain-containing protein -
  AAC934_RS13265 (AAC934_13265) - 2579464..2580549 (-) 1086 WP_033884469.1 glycosyl hydrolase -
  AAC934_RS13270 (AAC934_13270) rapE 2581293..2582420 (+) 1128 WP_031315220.1 response regulator aspartate phosphatase RapE -
  AAC934_RS13275 (AAC934_13275) phrE 2582410..2582544 (+) 135 WP_014114495.1 phosphatase RapE inhibitor PhrE -
  AAC934_RS13280 (AAC934_13280) - 2582654..2582813 (+) 160 Protein_2579 hypothetical protein -
  AAC934_RS13285 (AAC934_13285) - 2583182..2584948 (+) 1767 WP_342623051.1 T7SS effector LXG polymorphic toxin -
  AAC934_RS13290 (AAC934_13290) - 2584962..2585426 (+) 465 WP_015251659.1 SMI1/KNR4 family protein -
  AAC934_RS13295 (AAC934_13295) - 2585629..2586351 (-) 723 WP_342623053.1 NPP1 family protein -
  AAC934_RS13300 (AAC934_13300) cwlA 2586545..2587365 (-) 821 Protein_2583 N-acetylmuramoyl-L-alanine amidase -
  AAC934_RS13305 (AAC934_13305) - 2587409..2587549 (-) 141 Protein_2584 phage holin family protein -
  AAC934_RS13310 (AAC934_13310) - 2587576..2587761 (-) 186 Protein_2585 phage terminase large subunit -
  AAC934_RS13315 (AAC934_13315) terS 2587758..2588525 (-) 768 WP_317680594.1 phage terminase small subunit -
  AAC934_RS13320 (AAC934_13320) - 2588707..2588793 (+) 87 WP_073991391.1 YjcZ family sporulation protein -
  AAC934_RS13325 (AAC934_13325) - 2588834..2588926 (+) 93 WP_029318114.1 YjcZ family sporulation protein -
  AAC934_RS13330 (AAC934_13330) cotD 2589111..2589326 (-) 216 WP_076458314.1 spore coat protein CotD -
  AAC934_RS13335 (AAC934_13335) yqaQ 2589884..2590293 (-) 410 Protein_2590 sigma factor-like helix-turn-helix DNA-binding protein -
  AAC934_RS13340 (AAC934_13340) - 2590591..2590857 (+) 267 WP_029318115.1 hypothetical protein -
  AAC934_RS13345 (AAC934_13345) - 2590961..2591144 (-) 184 Protein_2592 hypothetical protein -
  AAC934_RS13350 (AAC934_13350) yqaO 2591216..2591422 (-) 207 Protein_2593 XtrA/YqaO family protein -
  AAC934_RS13355 (AAC934_13355) yqaN 2591506..2591925 (-) 420 Protein_2594 RusA family crossover junction endodeoxyribonuclease -
  AAC934_RS13360 (AAC934_13360) - 2592021..2592170 (-) 150 WP_076458162.1 hypothetical protein -
  AAC934_RS13365 (AAC934_13365) - 2592176..2592448 (-) 273 Protein_2596 ATP-binding protein -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=988627 AAC934_RS13230 WP_009967785.1 2571638..2572048(-) (nucA/comI) [Bacillus subtilis strain LP]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=988627 AAC934_RS13230 WP_009967785.1 2571638..2572048(-) (nucA/comI) [Bacillus subtilis strain LP]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCAGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTTCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment