Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHB67_RS14590 Genome accession   NZ_CP152051
Coordinates   2855713..2855853 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL H8-0516     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2850713..2860853
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB67_RS14565 (MHB67_14565) - 2850979..2851368 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  MHB67_RS14570 (MHB67_14570) comA 2851392..2852033 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  MHB67_RS14575 (MHB67_14575) comP 2852114..2854426 (-) 2313 WP_257802484.1 ATP-binding protein Regulator
  MHB67_RS14580 (MHB67_14580) comX 2854480..2854650 (-) 171 WP_073207246.1 competence pheromone ComX -
  MHB67_RS14585 (MHB67_14585) - 2854647..2855561 (-) 915 WP_024423324.1 polyprenyl synthetase family protein -
  MHB67_RS14590 (MHB67_14590) degQ 2855713..2855853 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHB67_RS14595 (MHB67_14595) - 2856359..2856715 (+) 357 WP_151039930.1 inner spore coat protein -
  MHB67_RS14600 (MHB67_14600) - 2856751..2857977 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  MHB67_RS14605 (MHB67_14605) - 2858115..2859587 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  MHB67_RS14610 (MHB67_14610) - 2859605..2860156 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  MHB67_RS14615 (MHB67_14615) - 2860217..2860624 (-) 408 WP_151863250.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=986942 MHB67_RS14590 WP_003213123.1 2855713..2855853(-) (degQ) [Bacillus sp. FSL H8-0516]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986942 MHB67_RS14590 WP_003213123.1 2855713..2855853(-) (degQ) [Bacillus sp. FSL H8-0516]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment