Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI16_RS14765 Genome accession   NZ_CP152044
Coordinates   2859906..2860046 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-0923     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2854906..2865046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI16_RS14740 (MHI16_14740) - 2855168..2855557 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  MHI16_RS14745 (MHI16_14745) comA 2855581..2856222 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  MHI16_RS14750 (MHI16_14750) comP 2856303..2858618 (-) 2316 WP_144461870.1 ATP-binding protein Regulator
  MHI16_RS14755 (MHI16_14755) comX 2858676..2858843 (-) 168 WP_081042274.1 competence pheromone ComX -
  MHI16_RS14760 (MHI16_14760) - 2858840..2859754 (-) 915 WP_061409480.1 polyprenyl synthetase family protein -
  MHI16_RS14765 (MHI16_14765) degQ 2859906..2860046 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHI16_RS14770 (MHI16_14770) - 2860552..2860905 (+) 354 WP_058013790.1 hypothetical protein -
  MHI16_RS14775 (MHI16_14775) - 2860937..2862163 (-) 1227 WP_012011110.1 HDOD domain-containing protein -
  MHI16_RS14780 (MHI16_14780) - 2862303..2863772 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  MHI16_RS14785 (MHI16_14785) - 2863790..2864341 (-) 552 WP_058013788.1 isochorismatase family cysteine hydrolase -
  MHI16_RS14790 (MHI16_14790) - 2864402..2864809 (-) 408 WP_058013787.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=986624 MHI16_RS14765 WP_003213123.1 2859906..2860046(-) (degQ) [Bacillus sp. FSL K6-0923]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986624 MHI16_RS14765 WP_003213123.1 2859906..2860046(-) (degQ) [Bacillus sp. FSL K6-0923]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment