Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8615_RS02490 | Genome accession | NZ_AP026929 |
| Coordinates | 478650..478799 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900701114 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 473650..483799
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8615_RS02465 (PC1101_04910) | comA/nlmT | 474717..476393 (-) | 1677 | WP_215729172.1 | peptide cleavage/export ABC transporter | Regulator |
| R8615_RS02470 (PC1101_04920) | comA/nlmT | 476287..476874 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8615_RS02475 (PC1101_04930) | blpI | 477156..477353 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| R8615_RS02480 (PC1101_04940) | blpJ | 477820..478089 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| R8615_RS02485 (PC1101_04950) | blpK | 478158..478406 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| R8615_RS02490 (PC1101_04960) | cipB | 478650..478799 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| R8615_RS10725 | - | 478835..478900 (+) | 66 | Protein_490 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| R8615_RS02495 | - | 478903..479022 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8615_RS02500 (PC1101_04980) | - | 479503..479861 (+) | 359 | Protein_492 | immunity protein | - |
| R8615_RS02505 (PC1101_05000) | - | 480490..480873 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| R8615_RS02510 (PC1101_05010) | - | 480925..481614 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8615_RS02515 (PC1101_05020) | blpZ | 481656..481889 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| R8615_RS02520 | - | 482040..482651 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8615_RS02525 (PC1101_05030) | ccrZ | 482812..483606 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=98652 R8615_RS02490 WP_001809846.1 478650..478799(+) (cipB) [Streptococcus pneumoniae strain PZ900701114]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=98652 R8615_RS02490 WP_001809846.1 478650..478799(+) (cipB) [Streptococcus pneumoniae strain PZ900701114]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |