Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI46_RS15105 Genome accession   NZ_CP152042
Coordinates   2885663..2885803 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-1000     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2880663..2890803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI46_RS15080 (MHI46_15080) - 2880928..2881317 (-) 390 WP_039181120.1 hotdog fold thioesterase -
  MHI46_RS15085 (MHI46_15085) comA 2881341..2881982 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  MHI46_RS15090 (MHI46_15090) comP 2882063..2884375 (-) 2313 WP_260774696.1 ATP-binding protein Regulator
  MHI46_RS15095 (MHI46_15095) comX 2884430..2884600 (-) 171 WP_181286101.1 competence pheromone ComX -
  MHI46_RS15100 (MHI46_15100) - 2884597..2885511 (-) 915 WP_260774697.1 polyprenyl synthetase family protein -
  MHI46_RS15105 (MHI46_15105) degQ 2885663..2885803 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHI46_RS15110 (MHI46_15110) - 2886309..2886665 (+) 357 WP_052773115.1 hypothetical protein -
  MHI46_RS15115 (MHI46_15115) - 2886701..2887927 (-) 1227 WP_047203313.1 HDOD domain-containing protein -
  MHI46_RS15120 (MHI46_15120) - 2888065..2889537 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  MHI46_RS15125 (MHI46_15125) - 2889555..2890106 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  MHI46_RS15130 (MHI46_15130) - 2890167..2890574 (-) 408 WP_251181229.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=986504 MHI46_RS15105 WP_003213123.1 2885663..2885803(-) (degQ) [Bacillus sp. FSL K6-1000]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986504 MHI46_RS15105 WP_003213123.1 2885663..2885803(-) (degQ) [Bacillus sp. FSL K6-1000]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment