Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MHI58_RS15430 Genome accession   NZ_CP152035
Coordinates   2964047..2964187 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-2869     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2959047..2969187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI58_RS15405 (MHI58_15405) - 2959313..2959702 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  MHI58_RS15410 (MHI58_15410) comA 2959726..2960367 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  MHI58_RS15415 (MHI58_15415) comP 2960448..2962760 (-) 2313 WP_041507704.1 ATP-binding protein Regulator
  MHI58_RS15420 (MHI58_15420) comX 2962814..2962984 (-) 171 WP_074041927.1 competence pheromone ComX -
  MHI58_RS15425 (MHI58_15425) - 2962981..2963895 (-) 915 WP_168948551.1 polyprenyl synthetase family protein -
  MHI58_RS15430 (MHI58_15430) degQ 2964047..2964187 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHI58_RS15435 (MHI58_15435) - 2964693..2965046 (+) 354 WP_017367963.1 hypothetical protein -
  MHI58_RS15440 (MHI58_15440) - 2965083..2966309 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  MHI58_RS15445 (MHI58_15445) - 2966450..2967919 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  MHI58_RS15450 (MHI58_15450) - 2967937..2968488 (-) 552 WP_025207909.1 cysteine hydrolase family protein -
  MHI58_RS15455 (MHI58_15455) - 2968549..2968956 (-) 408 WP_007500468.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=986084 MHI58_RS15430 WP_003213123.1 2964047..2964187(-) (degQ) [Bacillus sp. FSL K6-2869]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986084 MHI58_RS15430 WP_003213123.1 2964047..2964187(-) (degQ) [Bacillus sp. FSL K6-2869]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment