Detailed information    

insolico Bioinformatically predicted

Overview


Name   kre   Type   Regulator
Locus tag   MHI58_RS06775 Genome accession   NZ_CP152035
Coordinates   1344429..1344890 (-) Length   153 a.a.
NCBI ID   WP_008356877.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-2869     
Function   regulation of regulators (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1345056..1379388 1344429..1344890 flank 166


Gene organization within MGE regions


Location: 1344429..1379388
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI58_RS06775 (MHI58_06775) kre 1344429..1344890 (-) 462 WP_008356877.1 YkyB family protein Regulator
  MHI58_RS06780 (MHI58_06780) - 1345056..1346213 (-) 1158 WP_243173004.1 tyrosine-type recombinase/integrase -
  MHI58_RS06785 (MHI58_06785) - 1346258..1346731 (-) 474 WP_243173005.1 ImmA/IrrE family metallo-endopeptidase -
  MHI58_RS06790 (MHI58_06790) - 1346744..1347049 (-) 306 WP_106032416.1 helix-turn-helix domain-containing protein -
  MHI58_RS06795 (MHI58_06795) - 1347320..1347520 (+) 201 WP_243173037.1 helix-turn-helix domain-containing protein -
  MHI58_RS06800 (MHI58_06800) - 1347507..1347779 (+) 273 WP_243173006.1 hypothetical protein -
  MHI58_RS06805 (MHI58_06805) - 1347918..1348085 (+) 168 WP_243173007.1 hypothetical protein -
  MHI58_RS06810 (MHI58_06810) - 1348082..1348333 (+) 252 WP_243173008.1 hypothetical protein -
  MHI58_RS06815 (MHI58_06815) - 1348391..1348627 (+) 237 WP_243173009.1 hypothetical protein -
  MHI58_RS06820 (MHI58_06820) - 1348795..1349196 (+) 402 WP_243173010.1 hypothetical protein -
  MHI58_RS06825 (MHI58_06825) - 1349207..1349977 (+) 771 WP_243173011.1 Replication protein O -
  MHI58_RS06830 (MHI58_06830) - 1349970..1350329 (+) 360 WP_243173012.1 replicative helicase loader/inhibitor -
  MHI58_RS06835 (MHI58_06835) dnaB 1350326..1351654 (+) 1329 WP_243173013.1 replicative DNA helicase -
  MHI58_RS06840 (MHI58_06840) - 1351651..1351866 (+) 216 WP_144531709.1 hypothetical protein -
  MHI58_RS06845 (MHI58_06845) - 1351863..1352021 (+) 159 WP_216099811.1 BH0509 family protein -
  MHI58_RS06850 (MHI58_06850) - 1352058..1352177 (+) 120 WP_243173014.1 dUTP diphosphatase -
  MHI58_RS06855 (MHI58_06855) - 1352178..1352252 (+) 75 Protein_1296 dUTP diphosphatase -
  MHI58_RS06860 (MHI58_06860) - 1352277..1352723 (+) 447 WP_243173015.1 dUTP diphosphatase -
  MHI58_RS06865 (MHI58_06865) - 1352825..1353019 (+) 195 WP_243173016.1 XtrA/YqaO family protein -
  MHI58_RS06870 (MHI58_06870) - 1353117..1353308 (+) 192 WP_243173017.1 hypothetical protein -
  MHI58_RS06875 (MHI58_06875) - 1353323..1353826 (+) 504 WP_243173018.1 sigma factor-like helix-turn-helix DNA-binding protein -
  MHI58_RS06880 (MHI58_06880) - 1353816..1354250 (+) 435 WP_243173019.1 ArpU family phage packaging/lysis transcriptional regulator -
  MHI58_RS06885 (MHI58_06885) - 1354331..1354768 (+) 438 WP_243173020.1 hypothetical protein -
  MHI58_RS06890 (MHI58_06890) - 1354939..1355283 (+) 345 WP_243173021.1 structural protein -
  MHI58_RS06895 (MHI58_06895) - 1355412..1355573 (+) 162 WP_185106914.1 hypothetical protein -
  MHI58_RS06900 (MHI58_06900) - 1355577..1355957 (+) 381 WP_243173022.1 HNH endonuclease -
  MHI58_RS06905 (MHI58_06905) - 1355997..1356686 (+) 690 WP_243173023.1 hypothetical protein -
  MHI58_RS06910 (MHI58_06910) - 1356901..1357389 (+) 489 WP_061418885.1 phage terminase small subunit P27 family -
  MHI58_RS06915 (MHI58_06915) - 1357376..1359103 (+) 1728 WP_061418888.1 terminase large subunit -
  MHI58_RS06920 (MHI58_06920) - 1359118..1359318 (+) 201 WP_061418892.1 hypothetical protein -
  MHI58_RS06925 (MHI58_06925) - 1359325..1360560 (+) 1236 WP_061418895.1 phage portal protein -
  MHI58_RS06930 (MHI58_06930) - 1360538..1361128 (+) 591 WP_061418898.1 HK97 family phage prohead protease -
  MHI58_RS06935 (MHI58_06935) - 1361183..1362364 (+) 1182 WP_061418900.1 phage major capsid protein -
  MHI58_RS06940 (MHI58_06940) - 1362377..1362679 (+) 303 WP_034324998.1 head-tail connector protein -
  MHI58_RS06945 (MHI58_06945) - 1362661..1362993 (+) 333 WP_061418903.1 phage head closure protein -
  MHI58_RS06950 (MHI58_06950) - 1362993..1363376 (+) 384 WP_061418906.1 HK97-gp10 family putative phage morphogenesis protein -
  MHI58_RS06955 (MHI58_06955) - 1363373..1363771 (+) 399 WP_061418909.1 DUF3168 domain-containing protein -
  MHI58_RS06960 (MHI58_06960) - 1363786..1364394 (+) 609 WP_061418912.1 major tail protein -
  MHI58_RS06965 (MHI58_06965) - 1364472..1364792 (+) 321 WP_133254352.1 hypothetical protein -
  MHI58_RS06970 (MHI58_06970) - 1365028..1368690 (+) 3663 WP_061418918.1 phage tail tape measure protein -
  MHI58_RS06975 (MHI58_06975) - 1368687..1369514 (+) 828 WP_061418921.1 phage tail domain-containing protein -
  MHI58_RS06980 (MHI58_06980) - 1369525..1371426 (+) 1902 WP_061418924.1 phage tail protein -
  MHI58_RS06985 (MHI58_06985) - 1371468..1373372 (+) 1905 WP_368004402.1 right-handed parallel beta-helix repeat-containing protein -
  MHI58_RS06990 (MHI58_06990) - 1373372..1373668 (+) 297 WP_061418930.1 hypothetical protein -
  MHI58_RS06995 (MHI58_06995) - 1373649..1375076 (+) 1428 WP_061418933.1 BppU family phage baseplate upper protein -
  MHI58_RS07000 (MHI58_07000) - 1375090..1375371 (+) 282 WP_061418936.1 hypothetical protein -
  MHI58_RS07005 (MHI58_07005) - 1375368..1375508 (+) 141 WP_081105413.1 XkdX family protein -
  MHI58_RS07010 (MHI58_07010) - 1375542..1375754 (+) 213 WP_034324986.1 BhlA/UviB family holin-like peptide -
  MHI58_RS07015 (MHI58_07015) - 1375775..1376038 (+) 264 WP_061418939.1 phage holin -
  MHI58_RS07020 (MHI58_07020) - 1376099..1376899 (+) 801 WP_061418942.1 N-acetylmuramoyl-L-alanine amidase -
  MHI58_RS07025 (MHI58_07025) - 1377208..1377930 (+) 723 WP_061418945.1 hypothetical protein -
  MHI58_RS07030 (MHI58_07030) - 1378255..1379388 (+) 1134 WP_061418948.1 RapH N-terminal domain-containing protein -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 17711.30 Da        Isoelectric Point: 10.2452

>NTDB_id=986059 MHI58_RS06775 WP_008356877.1 1344429..1344890(-) (kre) [Bacillus sp. FSL K6-2869]
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGRKVGLHFSNNPKYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=986059 MHI58_RS06775 WP_008356877.1 1344429..1344890(-) (kre) [Bacillus sp. FSL K6-2869]
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGCCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAGAAAAGTGGGCCTACATTTCTCTAACAATCCCAAATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCATCTGCCACCAACTAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAATCGAGCGAAACAAATACTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACAAAACCTGTCTTCAAACGGCTCGGGGAAAGTTATTTTTAA

Domains


Predicted by InterproScan.

(14-127)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  kre Bacillus subtilis subsp. subtilis str. 168

75.974

100

0.765


Multiple sequence alignment