Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MHH61_RS04540 Genome accession   NZ_CP152033
Coordinates   824154..824294 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-3154     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 819154..829294
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH61_RS04515 (MHH61_04510) - 819488..819877 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  MHH61_RS04520 (MHH61_04515) comA 819901..820542 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  MHH61_RS04525 (MHH61_04520) comP 820623..822914 (-) 2292 WP_125586170.1 ATP-binding protein Regulator
  MHH61_RS04530 (MHH61_04525) comX 822928..823101 (-) 174 WP_024425944.1 competence pheromone ComX -
  MHH61_RS04535 (MHH61_04530) - 823079..824002 (-) 924 WP_024425945.1 polyprenyl synthetase family protein -
  MHH61_RS04540 (MHH61_04535) degQ 824154..824294 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHH61_RS04545 (MHH61_04540) - 824800..825156 (+) 357 WP_024425946.1 hypothetical protein -
  MHH61_RS04550 (MHH61_04545) - 825192..826418 (-) 1227 WP_024425947.1 EAL and HDOD domain-containing protein -
  MHH61_RS04555 (MHH61_04550) - 826556..827968 (-) 1413 WP_229137464.1 nicotinate phosphoribosyltransferase -
  MHH61_RS04560 (MHH61_04555) - 828046..828597 (-) 552 WP_125586168.1 cysteine hydrolase family protein -
  MHH61_RS04565 (MHH61_04560) - 828658..829065 (-) 408 WP_024423329.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985931 MHH61_RS04540 WP_003213123.1 824154..824294(-) (degQ) [Bacillus sp. FSL K6-3154]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985931 MHH61_RS04540 WP_003213123.1 824154..824294(-) (degQ) [Bacillus sp. FSL K6-3154]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment