Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MHH65_RS14890 Genome accession   NZ_CP152026
Coordinates   2866287..2866427 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL L8-0654     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2861287..2871427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH65_RS14865 (MHH65_14865) - 2861553..2861942 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  MHH65_RS14870 (MHH65_14870) comA 2861966..2862607 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  MHH65_RS14875 (MHH65_14875) comP 2862688..2865000 (-) 2313 WP_034282568.1 ATP-binding protein Regulator
  MHH65_RS14880 (MHH65_14880) comX 2865054..2865224 (-) 171 WP_073207246.1 competence pheromone ComX -
  MHH65_RS14885 (MHH65_14885) - 2865221..2866135 (-) 915 WP_176967247.1 polyprenyl synthetase family protein -
  MHH65_RS14890 (MHH65_14890) degQ 2866287..2866427 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHH65_RS14895 (MHH65_14895) - 2866933..2867289 (+) 357 WP_041115816.1 hypothetical protein -
  MHH65_RS14900 (MHH65_14900) - 2867325..2868551 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  MHH65_RS14905 (MHH65_14905) - 2868689..2870161 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  MHH65_RS14910 (MHH65_14910) - 2870179..2870730 (-) 552 WP_065215227.1 isochorismatase family cysteine hydrolase -
  MHH65_RS14915 (MHH65_14915) - 2870791..2871198 (-) 408 WP_034282575.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985590 MHH65_RS14890 WP_003213123.1 2866287..2866427(-) (degQ) [Bacillus sp. FSL L8-0654]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985590 MHH65_RS14890 WP_003213123.1 2866287..2866427(-) (degQ) [Bacillus sp. FSL L8-0654]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment