Detailed information
Bioinformatically predicted
Overview
| Name | comK | Type | Regulator |
| Locus tag | MHH75_RS05040 | Genome accession | NZ_CP152025 |
| Coordinates | 1006468..1006734 (+) | Length | 88 a.a. |
| NCBI ID | WP_120207461.1 | Uniprot ID | - |
| Organism | Bacillus sp. FSL L8-0661 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1006788..1046550 | 1006468..1006734 | flank | 54 |
Gene organization within MGE regions
Location: 1006468..1046550
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MHH75_RS05040 (MHH75_05040) | comK | 1006468..1006734 (+) | 267 | WP_120207461.1 | competence protein ComK | Regulator |
| MHH75_RS05045 (MHH75_05045) | - | 1006788..1007981 (-) | 1194 | WP_120207459.1 | tyrosine-type recombinase/integrase | - |
| MHH75_RS05050 (MHH75_05050) | - | 1007995..1008498 (-) | 504 | WP_120207457.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MHH75_RS05055 (MHH75_05055) | - | 1008564..1009496 (-) | 933 | WP_120207455.1 | hypothetical protein | - |
| MHH75_RS05060 (MHH75_05060) | - | 1009688..1010047 (-) | 360 | WP_113768142.1 | helix-turn-helix transcriptional regulator | - |
| MHH75_RS05065 (MHH75_05065) | - | 1010210..1010434 (+) | 225 | WP_120207453.1 | helix-turn-helix transcriptional regulator | - |
| MHH75_RS05070 (MHH75_05070) | - | 1010446..1010751 (+) | 306 | WP_008348790.1 | hypothetical protein | - |
| MHH75_RS05075 (MHH75_05075) | - | 1010748..1011437 (+) | 690 | WP_120207451.1 | ORF6C domain-containing protein | - |
| MHH75_RS05080 (MHH75_05080) | - | 1011504..1012073 (+) | 570 | WP_111927110.1 | helix-turn-helix transcriptional regulator | - |
| MHH75_RS05085 (MHH75_05085) | - | 1012070..1012354 (+) | 285 | WP_260985219.1 | YqaH family protein | - |
| MHH75_RS05090 (MHH75_05090) | - | 1012561..1012740 (+) | 180 | WP_034282992.1 | hypothetical protein | - |
| MHH75_RS05095 (MHH75_05095) | - | 1012743..1013693 (+) | 951 | WP_267527887.1 | lambda-exonuclease family protein | - |
| MHH75_RS05100 (MHH75_05100) | recT | 1013686..1014561 (+) | 876 | WP_267527886.1 | recombination protein RecT | - |
| MHH75_RS05105 (MHH75_05105) | - | 1014723..1015427 (+) | 705 | WP_342489457.1 | DnaD domain protein | - |
| MHH75_RS05110 (MHH75_05110) | - | 1015372..1016202 (+) | 831 | WP_342489458.1 | ATP-binding protein | - |
| MHH75_RS05115 (MHH75_05115) | - | 1016612..1016902 (+) | 291 | WP_267527888.1 | hypothetical protein | - |
| MHH75_RS05120 (MHH75_05120) | - | 1016892..1017308 (+) | 417 | WP_267527889.1 | DUF1064 domain-containing protein | - |
| MHH75_RS05125 (MHH75_05125) | - | 1017292..1017447 (+) | 156 | WP_162842487.1 | hypothetical protein | - |
| MHH75_RS05130 (MHH75_05130) | - | 1017523..1017723 (+) | 201 | WP_234712550.1 | XtrA/YqaO family protein | - |
| MHH75_RS05135 (MHH75_05135) | - | 1017741..1017989 (+) | 249 | WP_267527890.1 | hypothetical protein | - |
| MHH75_RS05140 (MHH75_05140) | - | 1017986..1019245 (+) | 1260 | WP_267527891.1 | DNA cytosine methyltransferase | - |
| MHH75_RS05145 (MHH75_05145) | - | 1019271..1019741 (+) | 471 | WP_120207429.1 | hypothetical protein | - |
| MHH75_RS05150 (MHH75_05150) | - | 1019769..1020161 (+) | 393 | WP_267527892.1 | hypothetical protein | - |
| MHH75_RS05155 (MHH75_05155) | - | 1020183..1020821 (+) | 639 | WP_267527893.1 | dUTP diphosphatase | - |
| MHH75_RS05160 (MHH75_05160) | - | 1020822..1021217 (+) | 396 | WP_267527894.1 | hypothetical protein | - |
| MHH75_RS05165 (MHH75_05165) | - | 1021217..1021816 (+) | 600 | WP_267527895.1 | hypothetical protein | - |
| MHH75_RS05170 (MHH75_05170) | - | 1021832..1022041 (+) | 210 | WP_120207417.1 | hypothetical protein | - |
| MHH75_RS05175 (MHH75_05175) | - | 1022038..1022463 (+) | 426 | WP_267527896.1 | hypothetical protein | - |
| MHH75_RS05180 (MHH75_05180) | - | 1022692..1022913 (+) | 222 | WP_267527897.1 | hypothetical protein | - |
| MHH75_RS05185 (MHH75_05185) | - | 1023007..1023129 (+) | 123 | WP_257215632.1 | hypothetical protein | - |
| MHH75_RS05190 (MHH75_05190) | - | 1023146..1023601 (+) | 456 | WP_024720093.1 | hypothetical protein | - |
| MHH75_RS05195 (MHH75_05195) | - | 1023982..1024161 (+) | 180 | WP_267527898.1 | hypothetical protein | - |
| MHH75_RS05200 (MHH75_05200) | - | 1024295..1024462 (+) | 168 | WP_267527899.1 | hypothetical protein | - |
| MHH75_RS05205 (MHH75_05205) | terS | 1024510..1025238 (+) | 729 | WP_267527900.1 | phage terminase small subunit | - |
| MHH75_RS05210 (MHH75_05210) | - | 1025225..1026427 (+) | 1203 | WP_267527901.1 | PBSX family phage terminase large subunit | - |
| MHH75_RS05215 (MHH75_05215) | - | 1026432..1027853 (+) | 1422 | WP_267527902.1 | phage portal protein | - |
| MHH75_RS05220 (MHH75_05220) | - | 1027837..1028031 (+) | 195 | WP_267527903.1 | hypothetical protein | - |
| MHH75_RS05225 (MHH75_05225) | - | 1028114..1028695 (+) | 582 | WP_267527904.1 | DUF4355 domain-containing protein | - |
| MHH75_RS05230 (MHH75_05230) | - | 1028708..1029607 (+) | 900 | WP_120207396.1 | phage major capsid protein | - |
| MHH75_RS05235 (MHH75_05235) | - | 1029607..1029759 (+) | 153 | WP_183002011.1 | hypothetical protein | - |
| MHH75_RS05240 (MHH75_05240) | - | 1029771..1030628 (+) | 858 | WP_183002010.1 | phage minor head protein | - |
| MHH75_RS05245 (MHH75_05245) | - | 1030628..1030963 (+) | 336 | WP_120207392.1 | phage head-tail connector protein | - |
| MHH75_RS05250 (MHH75_05250) | - | 1030968..1031468 (+) | 501 | WP_144487696.1 | hypothetical protein | - |
| MHH75_RS05255 (MHH75_05255) | - | 1031468..1031818 (+) | 351 | WP_144487695.1 | hypothetical protein | - |
| MHH75_RS05260 (MHH75_05260) | - | 1031811..1032290 (+) | 480 | WP_144487694.1 | hypothetical protein | - |
| MHH75_RS05265 (MHH75_05265) | - | 1032295..1033329 (+) | 1035 | WP_144487693.1 | DUF3383 family protein | - |
| MHH75_RS05270 (MHH75_05270) | - | 1033344..1033739 (+) | 396 | WP_056408011.1 | DUF3277 family protein | - |
| MHH75_RS05275 (MHH75_05275) | - | 1033831..1034133 (+) | 303 | WP_144487692.1 | hypothetical protein | - |
| MHH75_RS05280 (MHH75_05280) | - | 1034156..1034281 (+) | 126 | WP_260856995.1 | hypothetical protein | - |
| MHH75_RS05285 (MHH75_05285) | - | 1034282..1037896 (+) | 3615 | WP_267527905.1 | tape measure protein | - |
| MHH75_RS05290 (MHH75_05290) | - | 1037896..1038441 (+) | 546 | WP_120207382.1 | LysM domain-containing protein | - |
| MHH75_RS05295 (MHH75_05295) | - | 1038452..1038802 (+) | 351 | WP_120207380.1 | hypothetical protein | - |
| MHH75_RS05300 (MHH75_05300) | - | 1038789..1039784 (+) | 996 | WP_120207378.1 | hypothetical protein | - |
| MHH75_RS05305 (MHH75_05305) | - | 1039784..1040128 (+) | 345 | WP_120207376.1 | Gp138 family membrane-puncturing spike protein | - |
| MHH75_RS05310 (MHH75_05310) | - | 1040125..1040487 (+) | 363 | WP_144487689.1 | DUF2634 domain-containing protein | - |
| MHH75_RS05315 (MHH75_05315) | - | 1040477..1041655 (+) | 1179 | WP_144487688.1 | baseplate J/gp47 family protein | - |
| MHH75_RS05320 (MHH75_05320) | - | 1041648..1042277 (+) | 630 | WP_144487687.1 | DUF2612 domain-containing protein | - |
| MHH75_RS05325 (MHH75_05325) | - | 1042292..1043374 (+) | 1083 | WP_144487686.1 | hypothetical protein | - |
| MHH75_RS05330 (MHH75_05330) | - | 1043385..1043732 (+) | 348 | WP_144487685.1 | XkdW family protein | - |
| MHH75_RS05335 (MHH75_05335) | - | 1043722..1043913 (+) | 192 | WP_144487684.1 | XkdX family protein | - |
| MHH75_RS05340 (MHH75_05340) | - | 1043982..1044260 (+) | 279 | WP_113768186.1 | hemolysin XhlA family protein | - |
| MHH75_RS05345 (MHH75_05345) | - | 1044280..1044543 (+) | 264 | WP_144487683.1 | phage holin | - |
| MHH75_RS05350 (MHH75_05350) | - | 1044606..1045676 (+) | 1071 | WP_186321781.1 | acyltransferase family protein | - |
| MHH75_RS05355 (MHH75_05355) | - | 1045732..1046550 (+) | 819 | WP_267527906.1 | M15 family metallopeptidase | - |
Sequence
Protein
Download Length: 88 a.a. Molecular weight: 9935.36 Da Isoelectric Point: 5.8228
>NTDB_id=985491 MHH75_RS05040 WP_120207461.1 1006468..1006734(+) (comK) [Bacillus sp. FSL L8-0661]
MSGISETPLDSYVINQTTMAVLPVEEGKRVYSKVIERETSFYVELKPLQIIERSCRFFGSSYAGRKAGTYEVTGISHKPP
FEIQTLDI
MSGISETPLDSYVINQTTMAVLPVEEGKRVYSKVIERETSFYVELKPLQIIERSCRFFGSSYAGRKAGTYEVTGISHKPP
FEIQTLDI
Nucleotide
Download Length: 267 bp
>NTDB_id=985491 MHH75_RS05040 WP_120207461.1 1006468..1006734(+) (comK) [Bacillus sp. FSL L8-0661]
GTGTCAGGAATTAGTGAAACACCTTTAGATTCATACGTCATTAATCAAACAACAATGGCGGTCCTTCCAGTTGAAGAAGG
AAAAAGAGTATATTCAAAAGTTATAGAAAGAGAGACAAGCTTTTACGTTGAATTAAAGCCCCTGCAAATTATTGAACGCA
GCTGCAGATTCTTCGGCTCAAGCTATGCAGGCAGAAAGGCGGGAACATACGAAGTAACAGGAATTTCTCACAAGCCTCCA
TTTGAAATACAAACCCTTGATATATAA
GTGTCAGGAATTAGTGAAACACCTTTAGATTCATACGTCATTAATCAAACAACAATGGCGGTCCTTCCAGTTGAAGAAGG
AAAAAGAGTATATTCAAAAGTTATAGAAAGAGAGACAAGCTTTTACGTTGAATTAAAGCCCCTGCAAATTATTGAACGCA
GCTGCAGATTCTTCGGCTCAAGCTATGCAGGCAGAAAGGCGGGAACATACGAAGTAACAGGAATTTCTCACAAGCCTCCA
TTTGAAATACAAACCCTTGATATATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK | Bacillus subtilis subsp. subtilis str. 168 |
65 |
90.909 |
0.591 |