Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI41_RS14760 Genome accession   NZ_CP152023
Coordinates   2862301..2862441 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL M7-0307     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2857301..2867441
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI41_RS14735 (MHI41_14735) - 2857623..2858012 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  MHI41_RS14740 (MHI41_14740) comA 2858036..2858677 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  MHI41_RS14745 (MHI41_14745) comP 2858758..2861064 (-) 2307 WP_342494272.1 ATP-binding protein Regulator
  MHI41_RS14750 (MHI41_14750) comX 2861078..2861248 (-) 171 WP_017358941.1 competence pheromone ComX -
  MHI41_RS14755 (MHI41_14755) - 2861226..2862149 (-) 924 WP_017367962.1 polyprenyl synthetase family protein -
  MHI41_RS14760 (MHI41_14760) degQ 2862301..2862441 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHI41_RS14765 (MHI41_14765) - 2862947..2863300 (+) 354 WP_017358939.1 hypothetical protein -
  MHI41_RS14770 (MHI41_14770) - 2863337..2864563 (-) 1227 WP_035701209.1 HDOD domain-containing protein -
  MHI41_RS14775 (MHI41_14775) - 2864703..2866172 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  MHI41_RS14780 (MHI41_14780) - 2866190..2866741 (-) 552 WP_272511068.1 isochorismatase family cysteine hydrolase -
  MHI41_RS14785 (MHI41_14785) - 2866802..2867209 (-) 408 WP_272511069.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985407 MHI41_RS14760 WP_003213123.1 2862301..2862441(-) (degQ) [Bacillus sp. FSL M7-0307]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985407 MHI41_RS14760 WP_003213123.1 2862301..2862441(-) (degQ) [Bacillus sp. FSL M7-0307]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment