Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MKY83_RS15320 Genome accession   NZ_CP152015
Coordinates   2951412..2951552 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL M8-0266     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2946412..2956552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY83_RS15295 (MKY83_15295) - 2946734..2947123 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  MKY83_RS15300 (MKY83_15300) comA 2947147..2947788 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  MKY83_RS15305 (MKY83_15305) comP 2947869..2950175 (-) 2307 WP_044140820.1 ATP-binding protein Regulator
  MKY83_RS15310 (MKY83_15310) comX 2950189..2950359 (-) 171 WP_012011107.1 competence pheromone ComX -
  MKY83_RS15315 (MKY83_15315) - 2950337..2951260 (-) 924 WP_106029260.1 polyprenyl synthetase family protein -
  MKY83_RS15320 (MKY83_15320) degQ 2951412..2951552 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MKY83_RS15325 (MKY83_15325) - 2952058..2952411 (+) 354 WP_113768032.1 inner spore coat protein -
  MKY83_RS15330 (MKY83_15330) - 2952442..2953668 (-) 1227 WP_106066310.1 HDOD domain-containing protein -
  MKY83_RS15335 (MKY83_15335) - 2953810..2955279 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  MKY83_RS15340 (MKY83_15340) - 2955297..2955848 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  MKY83_RS15345 (MKY83_15345) - 2955909..2956316 (-) 408 WP_044140823.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985047 MKY83_RS15320 WP_003213123.1 2951412..2951552(-) (degQ) [Bacillus sp. FSL M8-0266]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985047 MKY83_RS15320 WP_003213123.1 2951412..2951552(-) (degQ) [Bacillus sp. FSL M8-0266]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment