Detailed information
Bioinformatically predicted
Overview
| Name | kre | Type | Regulator |
| Locus tag | MKY83_RS06995 | Genome accession | NZ_CP152015 |
| Coordinates | 1406388..1406849 (-) | Length | 153 a.a. |
| NCBI ID | WP_044139814.1 | Uniprot ID | A0AB34QXM2 |
| Organism | Bacillus sp. FSL M8-0266 | ||
| Function | regulation of regulators (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1407015..1443690 | 1406388..1406849 | flank | 166 |
Gene organization within MGE regions
Location: 1406388..1443690
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKY83_RS06995 (MKY83_06995) | kre | 1406388..1406849 (-) | 462 | WP_044139814.1 | YkyB family protein | Regulator |
| MKY83_RS07000 (MKY83_07000) | - | 1407015..1408172 (-) | 1158 | WP_047947392.1 | tyrosine-type recombinase/integrase | - |
| MKY83_RS07005 (MKY83_07005) | - | 1408217..1408693 (-) | 477 | WP_283924430.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MKY83_RS07010 (MKY83_07010) | - | 1408706..1409065 (-) | 360 | WP_061418827.1 | helix-turn-helix transcriptional regulator | - |
| MKY83_RS07015 (MKY83_07015) | - | 1409181..1409420 (+) | 240 | WP_283924431.1 | helix-turn-helix transcriptional regulator | - |
| MKY83_RS07020 (MKY83_07020) | - | 1409501..1409773 (+) | 273 | WP_283924432.1 | hypothetical protein | - |
| MKY83_RS07025 (MKY83_07025) | - | 1409923..1410573 (+) | 651 | WP_283924433.1 | Rha family transcriptional regulator | - |
| MKY83_RS07030 (MKY83_07030) | - | 1410765..1411220 (+) | 456 | WP_283924434.1 | hypothetical protein | - |
| MKY83_RS07035 (MKY83_07035) | - | 1411408..1411677 (-) | 270 | WP_283924435.1 | hypothetical protein | - |
| MKY83_RS07040 (MKY83_07040) | - | 1411818..1412579 (+) | 762 | WP_283924436.1 | hypothetical protein | - |
| MKY83_RS07045 (MKY83_07045) | - | 1412744..1413145 (+) | 402 | WP_075621652.1 | hypothetical protein | - |
| MKY83_RS07050 (MKY83_07050) | - | 1413156..1413926 (+) | 771 | WP_047947400.1 | hypothetical protein | - |
| MKY83_RS07055 (MKY83_07055) | - | 1413919..1414278 (+) | 360 | WP_250026781.1 | replicative helicase loader/inhibitor | - |
| MKY83_RS07060 (MKY83_07060) | dnaB | 1414275..1415603 (+) | 1329 | WP_061418855.1 | replicative DNA helicase | - |
| MKY83_RS07065 (MKY83_07065) | - | 1415862..1416236 (-) | 375 | WP_185106924.1 | hypothetical protein | - |
| MKY83_RS07070 (MKY83_07070) | - | 1416313..1416504 (+) | 192 | WP_185106922.1 | XtrA/YqaO family protein | - |
| MKY83_RS07075 (MKY83_07075) | - | 1416776..1417210 (+) | 435 | WP_185106920.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MKY83_RS07080 (MKY83_07080) | - | 1417291..1417938 (+) | 648 | WP_342488430.1 | hypothetical protein | - |
| MKY83_RS07085 (MKY83_07085) | - | 1418159..1418941 (+) | 783 | WP_276736209.1 | hypothetical protein | - |
| MKY83_RS07090 (MKY83_07090) | - | 1419191..1419568 (+) | 378 | WP_159159647.1 | HNH endonuclease | - |
| MKY83_RS07095 (MKY83_07095) | - | 1419641..1420324 (+) | 684 | WP_159159648.1 | hypothetical protein | - |
| MKY83_RS07100 (MKY83_07100) | - | 1420539..1421027 (+) | 489 | WP_342488431.1 | phage terminase small subunit P27 family | - |
| MKY83_RS07105 (MKY83_07105) | - | 1421014..1422741 (+) | 1728 | WP_342488432.1 | terminase TerL endonuclease subunit | - |
| MKY83_RS07110 (MKY83_07110) | - | 1422756..1422956 (+) | 201 | WP_106032436.1 | hypothetical protein | - |
| MKY83_RS07115 (MKY83_07115) | - | 1422963..1424198 (+) | 1236 | WP_342488434.1 | phage portal protein | - |
| MKY83_RS07120 (MKY83_07120) | - | 1424176..1424766 (+) | 591 | WP_185107940.1 | HK97 family phage prohead protease | - |
| MKY83_RS07125 (MKY83_07125) | - | 1424821..1426002 (+) | 1182 | WP_342488436.1 | phage major capsid protein | - |
| MKY83_RS07130 (MKY83_07130) | - | 1426015..1426317 (+) | 303 | WP_283924443.1 | head-tail connector protein | - |
| MKY83_RS07135 (MKY83_07135) | - | 1426299..1426631 (+) | 333 | WP_113387281.1 | head-tail adaptor protein | - |
| MKY83_RS07140 (MKY83_07140) | - | 1426631..1427014 (+) | 384 | WP_185106900.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MKY83_RS07145 (MKY83_07145) | - | 1427011..1427403 (+) | 393 | WP_342488440.1 | hypothetical protein | - |
| MKY83_RS07150 (MKY83_07150) | - | 1427418..1428026 (+) | 609 | WP_185106897.1 | major tail protein | - |
| MKY83_RS07155 (MKY83_07155) | - | 1428104..1428424 (+) | 321 | WP_268508155.1 | hypothetical protein | - |
| MKY83_RS07160 (MKY83_07160) | - | 1428652..1432314 (+) | 3663 | WP_283924445.1 | phage tail tape measure protein | - |
| MKY83_RS07165 (MKY83_07165) | - | 1432311..1433138 (+) | 828 | WP_283924446.1 | phage tail domain-containing protein | - |
| MKY83_RS07170 (MKY83_07170) | - | 1433147..1435048 (+) | 1902 | WP_342488442.1 | phage tail protein | - |
| MKY83_RS07175 (MKY83_07175) | - | 1435090..1436961 (+) | 1872 | WP_342488443.1 | right-handed parallel beta-helix repeat-containing protein | - |
| MKY83_RS07180 (MKY83_07180) | - | 1436973..1438577 (+) | 1605 | WP_283924449.1 | BppU family phage baseplate upper protein | - |
| MKY83_RS07185 (MKY83_07185) | - | 1438593..1438865 (+) | 273 | WP_265208112.1 | hypothetical protein | - |
| MKY83_RS07190 (MKY83_07190) | - | 1438862..1439008 (+) | 147 | WP_106038152.1 | XkdX family protein | - |
| MKY83_RS07195 (MKY83_07195) | - | 1439048..1439260 (+) | 213 | WP_034324986.1 | BhlA/UviB family holin-like peptide | - |
| MKY83_RS07200 (MKY83_07200) | - | 1439284..1439547 (+) | 264 | WP_265208113.1 | phage holin | - |
| MKY83_RS07205 (MKY83_07205) | - | 1439609..1440409 (+) | 801 | WP_283924450.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MKY83_RS07210 (MKY83_07210) | - | 1440497..1441324 (-) | 828 | WP_283924451.1 | HNH endonuclease | - |
| MKY83_RS07215 (MKY83_07215) | - | 1441396..1442253 (-) | 858 | WP_283924452.1 | SMI1/KNR4 family protein | - |
| MKY83_RS07220 (MKY83_07220) | - | 1442436..1443569 (+) | 1134 | WP_283924453.1 | aspartate phosphatase | - |
| MKY83_RS07225 (MKY83_07225) | - | 1443559..1443690 (+) | 132 | WP_265208118.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 17683.29 Da Isoelectric Point: 10.2294
>NTDB_id=985022 MKY83_RS06995 WP_044139814.1 1406388..1406849(-) (kre) [Bacillus sp. FSL M8-0266]
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGKKVGLHFSNNPKYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGKKVGLHFSNNPKYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF
Nucleotide
Download Length: 462 bp
>NTDB_id=985022 MKY83_RS06995 WP_044139814.1 1406388..1406849(-) (kre) [Bacillus sp. FSL M8-0266]
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGTCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAAAAAAGTGGGCCTACATTTCTCTAACAATCCCAAATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCACCTGCCACCAACCAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAACCGAGCAAAGCAAATCCTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACGAAACCCGTCTTCAAACGACTAGGGGAAAGTTATTTTTAA
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGTCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAAAAAAGTGGGCCTACATTTCTCTAACAATCCCAAATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCACCTGCCACCAACCAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAACCGAGCAAAGCAAATCCTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACGAAACCCGTCTTCAAACGACTAGGGGAAAGTTATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| kre | Bacillus subtilis subsp. subtilis str. 168 |
76.623 |
100 |
0.771 |