Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MKX52_RS14375 Genome accession   NZ_CP152014
Coordinates   2788767..2788907 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R5-0422     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2783767..2793907
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX52_RS14350 (MKX52_14350) - 2784089..2784478 (-) 390 WP_342490907.1 hotdog fold thioesterase -
  MKX52_RS14355 (MKX52_14355) comA 2784502..2785143 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  MKX52_RS14360 (MKX52_14360) comP 2785224..2787530 (-) 2307 WP_012011106.1 ATP-binding protein Regulator
  MKX52_RS14365 (MKX52_14365) comX 2787544..2787723 (-) 180 WP_313960228.1 competence pheromone ComX -
  MKX52_RS14370 (MKX52_14370) - 2787692..2788615 (-) 924 WP_342490908.1 polyprenyl synthetase family protein -
  MKX52_RS14375 (MKX52_14375) degQ 2788767..2788907 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MKX52_RS14380 (MKX52_14380) - 2789413..2789766 (+) 354 WP_088000860.1 inner spore coat protein -
  MKX52_RS14385 (MKX52_14385) - 2789798..2791024 (-) 1227 WP_012011110.1 HDOD domain-containing protein -
  MKX52_RS14390 (MKX52_14390) - 2791164..2792633 (-) 1470 WP_088000858.1 nicotinate phosphoribosyltransferase -
  MKX52_RS14395 (MKX52_14395) - 2792651..2793202 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  MKX52_RS14400 (MKX52_14400) - 2793263..2793670 (-) 408 WP_342490909.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=984986 MKX52_RS14375 WP_003213123.1 2788767..2788907(-) (degQ) [Bacillus sp. FSL R5-0422]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=984986 MKX52_RS14375 WP_003213123.1 2788767..2788907(-) (degQ) [Bacillus sp. FSL R5-0422]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment