Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYE28_RS13115 | Genome accession | NZ_CP152013 |
| Coordinates | 2657959..2658132 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. FSL R5-0443 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2652959..2663132
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE28_RS13100 (NYE28_13100) | gcvT | 2653772..2654872 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYE28_RS13105 (NYE28_13105) | - | 2655296..2656966 (+) | 1671 | WP_124934996.1 | SNF2-related protein | - |
| NYE28_RS13110 (NYE28_13110) | - | 2656988..2657782 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| NYE28_RS13115 (NYE28_13115) | sinI | 2657959..2658132 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| NYE28_RS13120 (NYE28_13120) | sinR | 2658166..2658501 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NYE28_RS13125 (NYE28_13125) | - | 2658549..2659334 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| NYE28_RS13130 (NYE28_13130) | - | 2659399..2659983 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| NYE28_RS13135 (NYE28_13135) | tapA | 2659955..2660626 (-) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYE28_RS13140 (NYE28_13140) | - | 2660885..2661214 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NYE28_RS13145 (NYE28_13145) | - | 2661254..2661433 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NYE28_RS13150 (NYE28_13150) | comGG | 2661490..2661867 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NYE28_RS13155 (NYE28_13155) | comGF | 2661868..2662368 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| NYE28_RS13160 (NYE28_13160) | comGE | 2662277..2662591 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| NYE28_RS13165 (NYE28_13165) | comGD | 2662575..2663012 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=984903 NYE28_RS13115 WP_003153105.1 2657959..2658132(+) (sinI) [Bacillus sp. FSL R5-0443]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=984903 NYE28_RS13115 WP_003153105.1 2657959..2658132(+) (sinI) [Bacillus sp. FSL R5-0443]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |