Detailed information
Bioinformatically predicted
Overview
| Name | kre | Type | Regulator |
| Locus tag | MKZ22_RS07030 | Genome accession | NZ_CP152009 |
| Coordinates | 1412555..1413016 (-) | Length | 153 a.a. |
| NCBI ID | WP_044139814.1 | Uniprot ID | A0AB34QXM2 |
| Organism | Bacillus sp. FSL R7-0675 | ||
| Function | regulation of regulators (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1413182..1465132 | 1412555..1413016 | flank | 166 |
Gene organization within MGE regions
Location: 1412555..1465132
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKZ22_RS07030 (MKZ22_07030) | kre | 1412555..1413016 (-) | 462 | WP_044139814.1 | YkyB family protein | Regulator |
| MKZ22_RS07035 (MKZ22_07035) | - | 1413182..1414339 (-) | 1158 | WP_047947392.1 | tyrosine-type recombinase/integrase | - |
| MKZ22_RS07040 (MKZ22_07040) | - | 1414384..1414860 (-) | 477 | WP_283924430.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MKZ22_RS07045 (MKZ22_07045) | - | 1414873..1415232 (-) | 360 | WP_061418827.1 | helix-turn-helix transcriptional regulator | - |
| MKZ22_RS07050 (MKZ22_07050) | - | 1415348..1415587 (+) | 240 | WP_283924431.1 | helix-turn-helix transcriptional regulator | - |
| MKZ22_RS07055 (MKZ22_07055) | - | 1415668..1415940 (+) | 273 | WP_283924432.1 | hypothetical protein | - |
| MKZ22_RS07060 (MKZ22_07060) | - | 1416090..1416740 (+) | 651 | WP_283924433.1 | Rha family transcriptional regulator | - |
| MKZ22_RS07065 (MKZ22_07065) | - | 1416932..1417387 (+) | 456 | WP_283924434.1 | hypothetical protein | - |
| MKZ22_RS07070 (MKZ22_07070) | - | 1417575..1417844 (-) | 270 | WP_283924435.1 | hypothetical protein | - |
| MKZ22_RS07075 (MKZ22_07075) | - | 1417985..1418746 (+) | 762 | WP_283924436.1 | hypothetical protein | - |
| MKZ22_RS07080 (MKZ22_07080) | - | 1418911..1419312 (+) | 402 | WP_075621652.1 | hypothetical protein | - |
| MKZ22_RS07085 (MKZ22_07085) | - | 1419323..1420093 (+) | 771 | WP_047947400.1 | hypothetical protein | - |
| MKZ22_RS07090 (MKZ22_07090) | - | 1420086..1420445 (+) | 360 | WP_250026781.1 | replicative helicase loader/inhibitor | - |
| MKZ22_RS07095 (MKZ22_07095) | dnaB | 1420442..1421770 (+) | 1329 | WP_061418855.1 | replicative DNA helicase | - |
| MKZ22_RS07100 (MKZ22_07100) | - | 1422029..1422403 (-) | 375 | WP_185106924.1 | hypothetical protein | - |
| MKZ22_RS07105 (MKZ22_07105) | - | 1422480..1422671 (+) | 192 | WP_185106922.1 | XtrA/YqaO family protein | - |
| MKZ22_RS07110 (MKZ22_07110) | - | 1422943..1423377 (+) | 435 | WP_185106920.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MKZ22_RS07115 (MKZ22_07115) | - | 1423458..1424105 (+) | 648 | WP_342488430.1 | hypothetical protein | - |
| MKZ22_RS07120 (MKZ22_07120) | - | 1424326..1425108 (+) | 783 | WP_276736209.1 | hypothetical protein | - |
| MKZ22_RS07125 (MKZ22_07125) | - | 1425358..1425735 (+) | 378 | WP_159159647.1 | HNH endonuclease | - |
| MKZ22_RS07130 (MKZ22_07130) | - | 1425808..1426491 (+) | 684 | WP_159159648.1 | hypothetical protein | - |
| MKZ22_RS07135 (MKZ22_07135) | - | 1426706..1427194 (+) | 489 | WP_342488431.1 | phage terminase small subunit P27 family | - |
| MKZ22_RS07140 (MKZ22_07140) | - | 1427181..1428908 (+) | 1728 | WP_342488432.1 | terminase TerL endonuclease subunit | - |
| MKZ22_RS07145 (MKZ22_07145) | - | 1428923..1429123 (+) | 201 | WP_106032436.1 | hypothetical protein | - |
| MKZ22_RS07150 (MKZ22_07150) | - | 1429130..1430365 (+) | 1236 | WP_342488434.1 | phage portal protein | - |
| MKZ22_RS07155 (MKZ22_07155) | - | 1430343..1430933 (+) | 591 | WP_185107940.1 | HK97 family phage prohead protease | - |
| MKZ22_RS07160 (MKZ22_07160) | - | 1430988..1432169 (+) | 1182 | WP_342488436.1 | phage major capsid protein | - |
| MKZ22_RS07165 (MKZ22_07165) | - | 1432182..1432484 (+) | 303 | WP_283924443.1 | head-tail connector protein | - |
| MKZ22_RS07170 (MKZ22_07170) | - | 1432466..1432798 (+) | 333 | WP_113387281.1 | head-tail adaptor protein | - |
| MKZ22_RS07175 (MKZ22_07175) | - | 1432798..1433181 (+) | 384 | WP_185106900.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MKZ22_RS07180 (MKZ22_07180) | - | 1433178..1433570 (+) | 393 | WP_342488440.1 | hypothetical protein | - |
| MKZ22_RS07185 (MKZ22_07185) | - | 1433585..1434193 (+) | 609 | WP_185106897.1 | major tail protein | - |
| MKZ22_RS07190 (MKZ22_07190) | - | 1434271..1434591 (+) | 321 | WP_268508155.1 | hypothetical protein | - |
| MKZ22_RS07195 (MKZ22_07195) | - | 1434819..1438481 (+) | 3663 | WP_283924445.1 | phage tail tape measure protein | - |
| MKZ22_RS07200 (MKZ22_07200) | - | 1438478..1439305 (+) | 828 | WP_283924446.1 | phage tail domain-containing protein | - |
| MKZ22_RS07205 (MKZ22_07205) | - | 1439314..1441215 (+) | 1902 | WP_342488442.1 | phage tail protein | - |
| MKZ22_RS07210 (MKZ22_07210) | - | 1441257..1443128 (+) | 1872 | WP_342488443.1 | right-handed parallel beta-helix repeat-containing protein | - |
| MKZ22_RS07215 (MKZ22_07215) | - | 1443140..1444744 (+) | 1605 | WP_283924449.1 | BppU family phage baseplate upper protein | - |
| MKZ22_RS07220 (MKZ22_07220) | - | 1444760..1445032 (+) | 273 | WP_265208112.1 | hypothetical protein | - |
| MKZ22_RS07225 (MKZ22_07225) | - | 1445029..1445175 (+) | 147 | WP_106038152.1 | XkdX family protein | - |
| MKZ22_RS07230 (MKZ22_07230) | - | 1445215..1445427 (+) | 213 | WP_034324986.1 | BhlA/UviB family holin-like peptide | - |
| MKZ22_RS07235 (MKZ22_07235) | - | 1445451..1445714 (+) | 264 | WP_265208113.1 | phage holin | - |
| MKZ22_RS07240 (MKZ22_07240) | - | 1445776..1446576 (+) | 801 | WP_283924450.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MKZ22_RS07245 (MKZ22_07245) | - | 1446664..1447491 (-) | 828 | WP_283924451.1 | HNH endonuclease | - |
| MKZ22_RS07250 (MKZ22_07250) | - | 1447563..1448420 (-) | 858 | WP_283924452.1 | SMI1/KNR4 family protein | - |
| MKZ22_RS07255 (MKZ22_07255) | - | 1448603..1449736 (+) | 1134 | WP_283924453.1 | aspartate phosphatase | - |
| MKZ22_RS07260 (MKZ22_07260) | - | 1449726..1449857 (+) | 132 | WP_265208118.1 | hypothetical protein | - |
| MKZ22_RS07265 (MKZ22_07265) | - | 1450411..1451304 (-) | 894 | WP_065097177.1 | helix-turn-helix domain-containing protein | - |
| MKZ22_RS07270 (MKZ22_07270) | - | 1451417..1452313 (+) | 897 | WP_065097178.1 | DMT family transporter | - |
| MKZ22_RS07275 (MKZ22_07275) | - | 1452510..1452725 (-) | 216 | WP_050945147.1 | hypothetical protein | - |
| MKZ22_RS07280 (MKZ22_07280) | - | 1452893..1453069 (+) | 177 | WP_164847174.1 | hypothetical protein | - |
| MKZ22_RS07285 (MKZ22_07285) | - | 1453334..1454611 (-) | 1278 | WP_342488444.1 | MFS transporter | - |
| MKZ22_RS07290 (MKZ22_07290) | - | 1454685..1455182 (-) | 498 | WP_342488445.1 | L,D-transpeptidase family protein | - |
| MKZ22_RS07295 (MKZ22_07295) | - | 1455339..1456196 (-) | 858 | WP_065097180.1 | metallophosphoesterase | - |
| MKZ22_RS07300 (MKZ22_07300) | fadH | 1456334..1457098 (+) | 765 | WP_065097181.1 | 2,4-dienoyl-CoA reductase | - |
| MKZ22_RS07305 (MKZ22_07305) | - | 1457163..1458383 (+) | 1221 | WP_065097182.1 | EAL-associated domain-containing protein | - |
| MKZ22_RS07310 (MKZ22_07310) | - | 1458687..1459583 (+) | 897 | WP_003210823.1 | manganese catalase family protein | - |
| MKZ22_RS07315 (MKZ22_07315) | - | 1459767..1460009 (+) | 243 | WP_003212254.1 | DUF1797 family protein | - |
| MKZ22_RS07320 (MKZ22_07320) | - | 1460152..1460667 (+) | 516 | WP_003212504.1 | ribonuclease H-like YkuK family protein | - |
| MKZ22_RS07325 (MKZ22_07325) | abbA | 1460817..1461008 (+) | 192 | WP_003210802.1 | antirepressor AbbA | - |
| MKZ22_RS07330 (MKZ22_07330) | cbpB | 1461155..1461598 (+) | 444 | WP_003210874.1 | cyclic-di-AMP-binding protein CbpB | - |
| MKZ22_RS07335 (MKZ22_07335) | - | 1461695..1462576 (+) | 882 | WP_342488446.1 | LysR family transcriptional regulator | - |
| MKZ22_RS07340 (MKZ22_07340) | - | 1462688..1463110 (+) | 423 | WP_065097411.1 | DUF4275 family protein | - |
| MKZ22_RS07345 (MKZ22_07345) | - | 1463298..1463774 (+) | 477 | WP_065097184.1 | flavodoxin | - |
| MKZ22_RS07350 (MKZ22_07350) | - | 1463764..1464657 (+) | 894 | WP_065097185.1 | hypothetical protein | - |
| MKZ22_RS07355 (MKZ22_07355) | - | 1464707..1465132 (+) | 426 | WP_065097412.1 | flavodoxin | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 17683.29 Da Isoelectric Point: 10.2294
>NTDB_id=984615 MKZ22_RS07030 WP_044139814.1 1412555..1413016(-) (kre) [Bacillus sp. FSL R7-0675]
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGKKVGLHFSNNPKYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGKKVGLHFSNNPKYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF
Nucleotide
Download Length: 462 bp
>NTDB_id=984615 MKZ22_RS07030 WP_044139814.1 1412555..1413016(-) (kre) [Bacillus sp. FSL R7-0675]
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGTCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAAAAAAGTGGGCCTACATTTCTCTAACAATCCCAAATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCACCTGCCACCAACCAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAACCGAGCAAAGCAAATCCTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACGAAACCCGTCTTCAAACGACTAGGGGAAAGTTATTTTTAA
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGTCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAAAAAAGTGGGCCTACATTTCTCTAACAATCCCAAATATAGTCAACAACAGTCCGACGTGCTGATTGAAATTGGAGAT
TATTATTTTCACCTGCCACCAACCAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAACCGAGCAAAGCAAATCCTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACGAAACCCGTCTTCAAACGACTAGGGGAAAGTTATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| kre | Bacillus subtilis subsp. subtilis str. 168 |
76.623 |
100 |
0.771 |