Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYE21_RS17015 Genome accession   NZ_CP151999
Coordinates   3258046..3258186 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. FSL K6-8391     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3253046..3263186
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE21_RS16990 (NYE21_16990) - 3253367..3253756 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  NYE21_RS16995 (NYE21_16995) comA 3253773..3254411 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  NYE21_RS17000 (NYE21_17000) - 3254498..3256797 (-) 2300 Protein_3294 ATP-binding protein -
  NYE21_RS17005 (NYE21_17005) comX 3256799..3256972 (-) 174 WP_009329510.1 competence pheromone ComX -
  NYE21_RS17010 (NYE21_17010) - 3256976..3257857 (-) 882 WP_095240160.1 polyprenyl synthetase family protein -
  NYE21_RS17015 (NYE21_17015) degQ 3258046..3258186 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  NYE21_RS17020 (NYE21_17020) - 3258672..3259019 (+) 348 WP_231105863.1 SDR family oxidoreductase -
  NYE21_RS17025 (NYE21_17025) - 3259062..3260282 (-) 1221 WP_003184864.1 HDOD domain-containing protein -
  NYE21_RS17030 (NYE21_17030) - 3260461..3261930 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  NYE21_RS17035 (NYE21_17035) - 3261948..3262499 (-) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  NYE21_RS17040 (NYE21_17040) - 3262684..3263085 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=984246 NYE21_RS17015 WP_003184860.1 3258046..3258186(-) (degQ) [Bacillus sp. FSL K6-8391]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=984246 NYE21_RS17015 WP_003184860.1 3258046..3258186(-) (degQ) [Bacillus sp. FSL K6-8391]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment