Detailed information    

insolico Bioinformatically predicted

Overview


Name   kre   Type   Regulator
Locus tag   NST73_RS06820 Genome accession   NZ_CP151989
Coordinates   1349066..1349527 (-) Length   153 a.a.
NCBI ID   WP_007498684.1    Uniprot ID   A0A9X0FXQ0
Organism   Bacillus sp. FSL W7-1034     
Function   regulation of regulators (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1349693..1387351 1349066..1349527 flank 166


Gene organization within MGE regions


Location: 1349066..1387351
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST73_RS06820 (NST73_06820) kre 1349066..1349527 (-) 462 WP_007498684.1 YkyB family protein Regulator
  NST73_RS06825 (NST73_06825) - 1349693..1350850 (-) 1158 WP_243173004.1 tyrosine-type recombinase/integrase -
  NST73_RS06830 (NST73_06830) - 1350895..1351368 (-) 474 WP_342499479.1 ImmA/IrrE family metallo-endopeptidase -
  NST73_RS06835 (NST73_06835) - 1351381..1351686 (-) 306 WP_106032416.1 helix-turn-helix transcriptional regulator -
  NST73_RS06840 (NST73_06840) - 1351958..1352158 (+) 201 WP_243173037.1 helix-turn-helix domain-containing protein -
  NST73_RS06845 (NST73_06845) - 1352145..1352417 (+) 273 WP_243173006.1 hypothetical protein -
  NST73_RS06850 (NST73_06850) - 1352556..1352723 (+) 168 WP_326378895.1 hypothetical protein -
  NST73_RS06855 (NST73_06855) - 1352720..1352971 (+) 252 WP_243173008.1 hypothetical protein -
  NST73_RS06860 (NST73_06860) - 1353029..1353265 (+) 237 WP_326378897.1 hypothetical protein -
  NST73_RS06865 (NST73_06865) - 1353433..1353834 (+) 402 WP_326378899.1 hypothetical protein -
  NST73_RS06870 (NST73_06870) - 1353845..1354615 (+) 771 WP_326378901.1 Replication protein O -
  NST73_RS06875 (NST73_06875) - 1354608..1354967 (+) 360 WP_326378903.1 replicative helicase loader/inhibitor -
  NST73_RS06880 (NST73_06880) dnaB 1354964..1356292 (+) 1329 WP_326378904.1 replicative DNA helicase -
  NST73_RS06885 (NST73_06885) - 1356289..1356504 (+) 216 WP_144531709.1 hypothetical protein -
  NST73_RS06890 (NST73_06890) - 1356501..1356659 (+) 159 WP_216099811.1 BH0509 family protein -
  NST73_RS06895 (NST73_06895) - 1356695..1357360 (+) 666 WP_326378907.1 dUTP diphosphatase -
  NST73_RS06900 (NST73_06900) - 1357463..1357657 (+) 195 WP_326378909.1 XtrA/YqaO family protein -
  NST73_RS06905 (NST73_06905) - 1357758..1357949 (+) 192 WP_326378910.1 hypothetical protein -
  NST73_RS06910 (NST73_06910) - 1357964..1358467 (+) 504 WP_342499480.1 sigma factor-like helix-turn-helix DNA-binding protein -
  NST73_RS06915 (NST73_06915) - 1358457..1358891 (+) 435 WP_243173019.1 ArpU family phage packaging/lysis transcriptional regulator -
  NST73_RS06920 (NST73_06920) - 1358973..1359194 (+) 222 WP_185107928.1 hypothetical protein -
  NST73_RS06925 (NST73_06925) - 1359341..1359562 (+) 222 WP_326377917.1 hypothetical protein -
  NST73_RS06930 (NST73_06930) - 1359678..1360022 (+) 345 WP_326377918.1 structural protein -
  NST73_RS06935 (NST73_06935) - 1360150..1360311 (+) 162 WP_185106914.1 hypothetical protein -
  NST73_RS06940 (NST73_06940) - 1360315..1360692 (+) 378 WP_342499481.1 HNH endonuclease -
  NST73_RS06945 (NST73_06945) - 1360954..1361442 (+) 489 WP_061418885.1 phage terminase small subunit P27 family -
  NST73_RS06950 (NST73_06950) - 1361429..1363156 (+) 1728 WP_342499482.1 terminase TerL endonuclease subunit -
  NST73_RS06955 (NST73_06955) - 1363171..1363371 (+) 201 WP_216942384.1 hypothetical protein -
  NST73_RS06960 (NST73_06960) - 1363378..1364613 (+) 1236 WP_144739477.1 phage portal protein -
  NST73_RS06965 (NST73_06965) - 1364591..1365181 (+) 591 WP_342499483.1 HK97 family phage prohead protease -
  NST73_RS06970 (NST73_06970) - 1365236..1366417 (+) 1182 WP_342499484.1 phage major capsid protein -
  NST73_RS06975 (NST73_06975) - 1366430..1366732 (+) 303 WP_211063501.1 head-tail connector protein -
  NST73_RS06980 (NST73_06980) - 1366714..1367046 (+) 333 WP_342499485.1 head-tail adaptor protein -
  NST73_RS06985 (NST73_06985) - 1367046..1367429 (+) 384 WP_073206589.1 HK97-gp10 family putative phage morphogenesis protein -
  NST73_RS06990 (NST73_06990) - 1367426..1367818 (+) 393 WP_212362278.1 hypothetical protein -
  NST73_RS06995 (NST73_06995) - 1367833..1368441 (+) 609 WP_342499486.1 major tail protein -
  NST73_RS07000 (NST73_07000) - 1368516..1368839 (+) 324 WP_061418915.1 hypothetical protein -
  NST73_RS07005 (NST73_07005) - 1369075..1372737 (+) 3663 WP_342499487.1 phage tail tape measure protein -
  NST73_RS07010 (NST73_07010) - 1372734..1373561 (+) 828 WP_340937675.1 phage tail domain-containing protein -
  NST73_RS07015 (NST73_07015) - 1373567..1375471 (+) 1905 WP_342499488.1 phage tail protein -
  NST73_RS07020 (NST73_07020) - 1375513..1377417 (+) 1905 WP_340937672.1 right-handed parallel beta-helix repeat-containing protein -
  NST73_RS07025 (NST73_07025) - 1377414..1377713 (+) 300 WP_342499489.1 hypothetical protein -
  NST73_RS07030 (NST73_07030) - 1377694..1379193 (+) 1500 WP_340937668.1 BppU family phage baseplate upper protein -
  NST73_RS07035 (NST73_07035) - 1379204..1379551 (+) 348 WP_165378956.1 XkdW family protein -
  NST73_RS07040 (NST73_07040) - 1379541..1379717 (+) 177 WP_340937665.1 XkdX family protein -
  NST73_RS07045 (NST73_07045) - 1379751..1379963 (+) 213 WP_034324986.1 BhlA/UviB family holin-like peptide -
  NST73_RS07050 (NST73_07050) - 1379984..1380247 (+) 264 WP_340937663.1 phage holin -
  NST73_RS07055 (NST73_07055) - 1380307..1381107 (+) 801 WP_061418942.1 N-acetylmuramoyl-L-alanine amidase -
  NST73_RS07060 (NST73_07060) - 1381415..1382137 (+) 723 WP_061418945.1 hypothetical protein -
  NST73_RS07065 (NST73_07065) - 1382462..1383595 (+) 1134 WP_061418948.1 RapH N-terminal domain-containing protein -
  NST73_RS07070 (NST73_07070) - 1383585..1383722 (+) 138 WP_165378952.1 hypothetical protein -
  NST73_RS07075 (NST73_07075) - 1383750..1383941 (-) 192 WP_144739449.1 hypothetical protein -
  NST73_RS07080 (NST73_07080) - 1384725..1384940 (-) 216 WP_058337408.1 hypothetical protein -
  NST73_RS07085 (NST73_07085) - 1385106..1385282 (+) 177 WP_162837046.1 hypothetical protein -
  NST73_RS07090 (NST73_07090) - 1385503..1386780 (-) 1278 WP_083588753.1 MFS transporter -
  NST73_RS07095 (NST73_07095) - 1386854..1387351 (-) 498 WP_024719572.1 L,D-transpeptidase family protein -

Sequence


Protein


Download         Length: 153 a.a.        Molecular weight: 17739.31 Da        Isoelectric Point: 10.2617

>NTDB_id=983732 NST73_RS06820 WP_007498684.1 1349066..1349527(-) (kre) [Bacillus sp. FSL W7-1034]
MDDYAHTKDIEPTAENIAKAIYTVNRHAKTAPNPKFLYLLKKRALQKLLQEGKGRKVGLHFSNNPRYSQQQSDVLIEIGD
YYFHLPPTKEDFEFLPHLGNLNQSYRNPKANMSLNRAKQILQTYVGLKEKPAATKQKSHYTKPVFKRLGESYF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=983732 NST73_RS06820 WP_007498684.1 1349066..1349527(-) (kre) [Bacillus sp. FSL W7-1034]
ATGGACGATTATGCTCATACTAAAGACATAGAACCTACAGCAGAAAACATCGCAAAAGCCATTTATACTGTTAACCGCCA
TGCTAAAACCGCACCAAATCCCAAGTTTCTTTATCTTTTGAAAAAACGTGCGCTGCAAAAACTATTGCAAGAAGGTAAAG
GAAGAAAAGTGGGCCTACATTTCTCTAACAATCCCAGATATAGTCAACAACAGTCCGACGTGCTGATTGAAATCGGAGAT
TATTATTTTCATCTGCCACCAACTAAAGAAGACTTCGAATTTTTGCCACACTTAGGAAATTTAAATCAATCATATCGCAA
TCCGAAAGCGAATATGTCATTAAATCGAGCAAAACAAATACTTCAAACGTATGTCGGTTTAAAAGAAAAACCTGCCGCCA
CAAAACAAAAATCACATTATACAAAACCCGTCTTCAAACGGCTCGGGGAAAGTTATTTTTAA

Domains


Predicted by InterproScan.

(14-127)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  kre Bacillus subtilis subsp. subtilis str. 168

76.623

100

0.771


Multiple sequence alignment