Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSS80_RS15705 Genome accession   NZ_CP151985
Coordinates   2979951..2980091 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL M8-0350     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2974951..2985091
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSS80_RS15680 (NSS80_15680) - 2975216..2975605 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NSS80_RS15685 (NSS80_15685) comA 2975629..2976270 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  NSS80_RS15690 (NSS80_15690) comP 2976351..2978663 (-) 2313 WP_041115820.1 ATP-binding protein Regulator
  NSS80_RS15695 (NSS80_15695) comX 2978721..2978888 (-) 168 WP_080696376.1 competence pheromone ComX -
  NSS80_RS15700 (NSS80_15700) - 2978885..2979799 (-) 915 WP_041115818.1 polyprenyl synthetase family protein -
  NSS80_RS15705 (NSS80_15705) degQ 2979951..2980091 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSS80_RS15710 (NSS80_15710) - 2980597..2980953 (+) 357 WP_041115816.1 hypothetical protein -
  NSS80_RS15715 (NSS80_15715) - 2980989..2982215 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  NSS80_RS15720 (NSS80_15720) - 2982353..2983825 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  NSS80_RS15725 (NSS80_15725) - 2983843..2984394 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  NSS80_RS15730 (NSS80_15730) - 2984455..2984862 (-) 408 WP_317221863.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983511 NSS80_RS15705 WP_003213123.1 2979951..2980091(-) (degQ) [Bacillus sp. FSL M8-0350]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983511 NSS80_RS15705 WP_003213123.1 2979951..2980091(-) (degQ) [Bacillus sp. FSL M8-0350]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment