Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NSQ25_RS14620 Genome accession   NZ_CP151982
Coordinates   2822162..2822302 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R5-0512     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2817162..2827302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ25_RS14595 (NSQ25_14595) - 2817427..2817816 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NSQ25_RS14600 (NSQ25_14600) comA 2817840..2818481 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  NSQ25_RS14605 (NSQ25_14605) comP 2818562..2820874 (-) 2313 WP_120207602.1 ATP-binding protein Regulator
  NSQ25_RS14610 (NSQ25_14610) comX 2820932..2821099 (-) 168 WP_080696376.1 competence pheromone ComX -
  NSQ25_RS14615 (NSQ25_14615) - 2821096..2822010 (-) 915 WP_070325968.1 polyprenyl synthetase family protein -
  NSQ25_RS14620 (NSQ25_14620) degQ 2822162..2822302 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSQ25_RS14625 (NSQ25_14625) - 2822808..2823164 (+) 357 WP_041115816.1 hypothetical protein -
  NSQ25_RS14630 (NSQ25_14630) - 2823200..2824426 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  NSQ25_RS14635 (NSQ25_14635) - 2824564..2826036 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  NSQ25_RS14640 (NSQ25_14640) - 2826054..2826605 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  NSQ25_RS14645 (NSQ25_14645) - 2826656..2827072 (-) 417 WP_326135724.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983327 NSQ25_RS14620 WP_003213123.1 2822162..2822302(-) (degQ) [Bacillus sp. FSL R5-0512]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983327 NSQ25_RS14620 WP_003213123.1 2822162..2822302(-) (degQ) [Bacillus sp. FSL R5-0512]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment