Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSU11_RS15430 Genome accession   NZ_CP151981
Coordinates   2974203..2974343 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R5-0712     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2969203..2979343
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSU11_RS15405 (NSU11_15405) - 2969463..2969852 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NSU11_RS15410 (NSU11_15410) comA 2969876..2970517 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  NSU11_RS15415 (NSU11_15415) comP 2970598..2972910 (-) 2313 WP_270127242.1 ATP-binding protein Regulator
  NSU11_RS15420 (NSU11_15420) comX 2972973..2973140 (-) 168 WP_080696376.1 competence pheromone ComX -
  NSU11_RS15425 (NSU11_15425) - 2973137..2974051 (-) 915 WP_025094184.1 polyprenyl synthetase family protein -
  NSU11_RS15430 (NSU11_15430) degQ 2974203..2974343 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSU11_RS15435 (NSU11_15435) - 2974849..2975205 (+) 357 WP_024425946.1 hypothetical protein -
  NSU11_RS15440 (NSU11_15440) - 2975241..2976467 (-) 1227 WP_342493908.1 HDOD domain-containing protein -
  NSU11_RS15445 (NSU11_15445) - 2976605..2978077 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  NSU11_RS15450 (NSU11_15450) - 2978095..2978646 (-) 552 WP_024423328.1 isochorismatase family cysteine hydrolase -
  NSU11_RS15455 (NSU11_15455) - 2978707..2979114 (-) 408 WP_024423329.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983266 NSU11_RS15430 WP_003213123.1 2974203..2974343(-) (degQ) [Bacillus sp. FSL R5-0712]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983266 NSU11_RS15430 WP_003213123.1 2974203..2974343(-) (degQ) [Bacillus sp. FSL R5-0712]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment