Detailed information
Bioinformatically predicted
Overview
| Name | comK | Type | Regulator |
| Locus tag | NST32_RS05110 | Genome accession | NZ_CP151978 |
| Coordinates | 1017368..1017664 (+) | Length | 98 a.a. |
| NCBI ID | WP_342474675.1 | Uniprot ID | - |
| Organism | Bacillus sp. FSL L8-0215 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1017689..1058532 | 1017368..1017664 | flank | 25 |
Gene organization within MGE regions
Location: 1017368..1058532
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NST32_RS05110 (NST32_05110) | comK | 1017368..1017664 (+) | 297 | WP_342474675.1 | competence protein ComK | Regulator |
| NST32_RS05115 (NST32_05115) | - | 1017689..1018882 (-) | 1194 | WP_110487432.1 | tyrosine-type recombinase/integrase | - |
| NST32_RS05120 (NST32_05120) | - | 1018896..1019399 (-) | 504 | WP_342474676.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NST32_RS05125 (NST32_05125) | - | 1019466..1020227 (-) | 762 | WP_342474677.1 | hypothetical protein | - |
| NST32_RS05130 (NST32_05130) | - | 1020527..1020937 (-) | 411 | WP_342474678.1 | helix-turn-helix transcriptional regulator | - |
| NST32_RS05135 (NST32_05135) | - | 1021083..1021292 (+) | 210 | WP_307499201.1 | helix-turn-helix transcriptional regulator | - |
| NST32_RS05140 (NST32_05140) | - | 1021341..1021523 (+) | 183 | WP_110487434.1 | hypothetical protein | - |
| NST32_RS05145 (NST32_05145) | - | 1021829..1022134 (+) | 306 | WP_110487436.1 | hypothetical protein | - |
| NST32_RS05150 (NST32_05150) | - | 1022131..1022877 (+) | 747 | WP_342474679.1 | Rha family transcriptional regulator | - |
| NST32_RS05155 (NST32_05155) | - | 1022936..1023505 (+) | 570 | WP_342474680.1 | helix-turn-helix transcriptional regulator | - |
| NST32_RS05160 (NST32_05160) | - | 1023502..1023786 (+) | 285 | WP_342474681.1 | YqaH family protein | - |
| NST32_RS05165 (NST32_05165) | - | 1023995..1024183 (+) | 189 | WP_039167514.1 | hypothetical protein | - |
| NST32_RS05170 (NST32_05170) | - | 1024176..1024355 (+) | 180 | WP_039167513.1 | hypothetical protein | - |
| NST32_RS05175 (NST32_05175) | - | 1024355..1025305 (+) | 951 | WP_342474682.1 | lambda-exonuclease family protein | - |
| NST32_RS05180 (NST32_05180) | - | 1025305..1026144 (+) | 840 | WP_342474683.1 | recombinase RecT | - |
| NST32_RS05185 (NST32_05185) | - | 1026306..1026950 (+) | 645 | WP_342474684.1 | DnaD domain protein | - |
| NST32_RS05190 (NST32_05190) | - | 1026853..1027782 (+) | 930 | WP_342474685.1 | DnaA/Hda family protein | - |
| NST32_RS05195 (NST32_05195) | - | 1028053..1028448 (+) | 396 | WP_342474686.1 | YopX family protein | - |
| NST32_RS05200 (NST32_05200) | - | 1028567..1029022 (+) | 456 | WP_342474687.1 | DUF1064 domain-containing protein | - |
| NST32_RS05205 (NST32_05205) | - | 1029136..1029291 (+) | 156 | WP_008348759.1 | hypothetical protein | - |
| NST32_RS05210 (NST32_05210) | - | 1029370..1029573 (+) | 204 | WP_342474688.1 | XtrA/YqaO family protein | - |
| NST32_RS05215 (NST32_05215) | - | 1029590..1029976 (+) | 387 | WP_342474689.1 | hypothetical protein | - |
| NST32_RS05220 (NST32_05220) | - | 1029976..1030242 (+) | 267 | WP_342474690.1 | hypothetical protein | - |
| NST32_RS05225 (NST32_05225) | - | 1030239..1030487 (+) | 249 | WP_342474691.1 | hypothetical protein | - |
| NST32_RS05230 (NST32_05230) | - | 1030715..1031440 (+) | 726 | WP_342474692.1 | hypothetical protein | - |
| NST32_RS05235 (NST32_05235) | - | 1031536..1031658 (+) | 123 | WP_258521774.1 | hypothetical protein | - |
| NST32_RS05240 (NST32_05240) | - | 1031668..1032156 (+) | 489 | WP_342474693.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| NST32_RS05245 (NST32_05245) | - | 1032160..1032615 (+) | 456 | WP_024720093.1 | hypothetical protein | - |
| NST32_RS05250 (NST32_05250) | - | 1032756..1033232 (+) | 477 | WP_342474694.1 | hypothetical protein | - |
| NST32_RS05255 (NST32_05255) | - | 1033238..1033702 (+) | 465 | WP_342474695.1 | hypothetical protein | - |
| NST32_RS05260 (NST32_05260) | - | 1033878..1034096 (+) | 219 | WP_342474696.1 | hypothetical protein | - |
| NST32_RS05265 (NST32_05265) | - | 1034117..1034587 (+) | 471 | WP_342474697.1 | hypothetical protein | - |
| NST32_RS05270 (NST32_05270) | terS | 1034662..1035402 (+) | 741 | WP_342474698.1 | phage terminase small subunit | - |
| NST32_RS05275 (NST32_05275) | - | 1035389..1036591 (+) | 1203 | WP_342474699.1 | PBSX family phage terminase large subunit | - |
| NST32_RS05280 (NST32_05280) | - | 1036596..1038041 (+) | 1446 | WP_342474700.1 | phage portal protein | - |
| NST32_RS05285 (NST32_05285) | - | 1038075..1038653 (+) | 579 | WP_342474701.1 | DUF4355 domain-containing protein | - |
| NST32_RS05290 (NST32_05290) | - | 1038665..1039600 (+) | 936 | WP_342474702.1 | phage major capsid protein | - |
| NST32_RS05295 (NST32_05295) | - | 1039600..1039749 (+) | 150 | WP_342474703.1 | hypothetical protein | - |
| NST32_RS05300 (NST32_05300) | - | 1039761..1040618 (+) | 858 | WP_047947200.1 | phage minor head protein | - |
| NST32_RS05305 (NST32_05305) | - | 1040618..1040953 (+) | 336 | WP_047947199.1 | phage head-tail connector protein | - |
| NST32_RS05310 (NST32_05310) | - | 1040958..1041458 (+) | 501 | WP_047947198.1 | hypothetical protein | - |
| NST32_RS05315 (NST32_05315) | - | 1041458..1041808 (+) | 351 | WP_342474704.1 | hypothetical protein | - |
| NST32_RS05320 (NST32_05320) | - | 1041801..1042280 (+) | 480 | WP_082136095.1 | hypothetical protein | - |
| NST32_RS05325 (NST32_05325) | - | 1042285..1043319 (+) | 1035 | WP_342474705.1 | DUF3383 family protein | - |
| NST32_RS05330 (NST32_05330) | - | 1043334..1043735 (+) | 402 | WP_047947195.1 | DUF3277 family protein | - |
| NST32_RS05335 (NST32_05335) | - | 1043827..1044129 (+) | 303 | WP_342474706.1 | hypothetical protein | - |
| NST32_RS05340 (NST32_05340) | - | 1044152..1044277 (+) | 126 | WP_008348699.1 | hypothetical protein | - |
| NST32_RS05345 (NST32_05345) | - | 1044278..1047928 (+) | 3651 | WP_342474707.1 | tape measure protein | - |
| NST32_RS05350 (NST32_05350) | - | 1047928..1048473 (+) | 546 | WP_120207382.1 | LysM domain-containing protein | - |
| NST32_RS05355 (NST32_05355) | - | 1048484..1048834 (+) | 351 | WP_008348692.1 | hypothetical protein | - |
| NST32_RS05360 (NST32_05360) | - | 1048821..1049816 (+) | 996 | WP_144487691.1 | hypothetical protein | - |
| NST32_RS05365 (NST32_05365) | - | 1049816..1050160 (+) | 345 | WP_047947190.1 | Gp138 family membrane-puncturing spike protein | - |
| NST32_RS05370 (NST32_05370) | - | 1050157..1050519 (+) | 363 | WP_224930513.1 | DUF2634 domain-containing protein | - |
| NST32_RS05375 (NST32_05375) | - | 1050500..1051684 (+) | 1185 | WP_342474708.1 | baseplate J/gp47 family protein | - |
| NST32_RS05380 (NST32_05380) | - | 1051681..1052310 (+) | 630 | WP_342474709.1 | hypothetical protein | - |
| NST32_RS05385 (NST32_05385) | - | 1052322..1053410 (+) | 1089 | WP_342474710.1 | hypothetical protein | - |
| NST32_RS05390 (NST32_05390) | - | 1053421..1053759 (+) | 339 | WP_342474711.1 | XkdW family protein | - |
| NST32_RS05395 (NST32_05395) | - | 1053759..1053950 (+) | 192 | WP_008348673.1 | XkdX family protein | - |
| NST32_RS05400 (NST32_05400) | - | 1054012..1054224 (+) | 213 | WP_025092921.1 | BhlA/UviB family holin-like peptide | - |
| NST32_RS05405 (NST32_05405) | - | 1054240..1054503 (+) | 264 | WP_342474712.1 | phage holin | - |
| NST32_RS05410 (NST32_05410) | - | 1054561..1055379 (+) | 819 | WP_342474713.1 | M15 family metallopeptidase | - |
| NST32_RS05415 (NST32_05415) | - | 1055409..1055621 (-) | 213 | WP_342474714.1 | hypothetical protein | - |
| NST32_RS05420 (NST32_05420) | - | 1055639..1056232 (-) | 594 | WP_342474715.1 | hypothetical protein | - |
| NST32_RS05425 (NST32_05425) | - | 1056710..1056967 (+) | 258 | WP_342474716.1 | helix-turn-helix domain-containing protein | - |
| NST32_RS05430 (NST32_05430) | - | 1057105..1058532 (+) | 1428 | WP_342474717.1 | viroplasmin family protein | - |
Sequence
Protein
Download Length: 98 a.a. Molecular weight: 10934.58 Da Isoelectric Point: 7.9817
>NTDB_id=983071 NST32_RS05110 WP_342474675.1 1017368..1017664(+) (comK) [Bacillus sp. FSL L8-0215]
MSGISETPLDSYVINQTTMAVLPVEEGKRVYSKVIERETSFYVELKPLQIIERSCRFFGSSYAGRKAGTYEVTGISHKPP
TDIKTLVIKGFVGNDPIF
MSGISETPLDSYVINQTTMAVLPVEEGKRVYSKVIERETSFYVELKPLQIIERSCRFFGSSYAGRKAGTYEVTGISHKPP
TDIKTLVIKGFVGNDPIF
Nucleotide
Download Length: 297 bp
>NTDB_id=983071 NST32_RS05110 WP_342474675.1 1017368..1017664(+) (comK) [Bacillus sp. FSL L8-0215]
GTGTCAGGAATTAGTGAAACACCTTTAGATTCATACGTCATTAATCAAACAACAATGGCGGTCCTTCCAGTTGAAGAAGG
AAAAAGAGTATATTCAAAAGTTATAGAAAGAGAGACAAGCTTTTACGTTGAATTAAAGCCCCTGCAAATTATTGAACGCA
GCTGCAGATTCTTCGGCTCAAGCTATGCAGGCAGAAAGGCGGGAACATACGAAGTAACAGGAATTTCTCACAAGCCTCCA
ACAGATATAAAAACCCTTGTTATAAAAGGATTTGTAGGCAATGATCCTATTTTTTGA
GTGTCAGGAATTAGTGAAACACCTTTAGATTCATACGTCATTAATCAAACAACAATGGCGGTCCTTCCAGTTGAAGAAGG
AAAAAGAGTATATTCAAAAGTTATAGAAAGAGAGACAAGCTTTTACGTTGAATTAAAGCCCCTGCAAATTATTGAACGCA
GCTGCAGATTCTTCGGCTCAAGCTATGCAGGCAGAAAGGCGGGAACATACGAAGTAACAGGAATTTCTCACAAGCCTCCA
ACAGATATAAAAACCCTTGTTATAAAAGGATTTGTAGGCAATGATCCTATTTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK | Bacillus subtilis subsp. subtilis str. 168 |
65 |
81.633 |
0.531 |