Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NST24_RS15030 Genome accession   NZ_CP151977
Coordinates   2899068..2899208 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R5-0286     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2894068..2904208
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST24_RS15005 (NST24_15005) - 2894390..2894779 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  NST24_RS15010 (NST24_15010) comA 2894803..2895444 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NST24_RS15015 (NST24_15015) comP 2895525..2897831 (-) 2307 WP_073412603.1 ATP-binding protein Regulator
  NST24_RS15020 (NST24_15020) comX 2897845..2898015 (-) 171 WP_017358941.1 competence pheromone ComX -
  NST24_RS15025 (NST24_15025) - 2897993..2898916 (-) 924 WP_008345863.1 polyprenyl synthetase family protein -
  NST24_RS15030 (NST24_15030) degQ 2899068..2899208 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NST24_RS15035 (NST24_15035) - 2899714..2900067 (+) 354 WP_251185038.1 inner spore coat protein -
  NST24_RS15040 (NST24_15040) - 2900104..2901330 (-) 1227 WP_035701209.1 HDOD domain-containing protein -
  NST24_RS15045 (NST24_15045) - 2901471..2902940 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  NST24_RS15050 (NST24_15050) - 2902958..2903509 (-) 552 WP_008345872.1 isochorismatase family cysteine hydrolase -
  NST24_RS15055 (NST24_15055) - 2903570..2903977 (-) 408 WP_007500468.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983047 NST24_RS15030 WP_003213123.1 2899068..2899208(-) (degQ) [Bacillus sp. FSL R5-0286]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983047 NST24_RS15030 WP_003213123.1 2899068..2899208(-) (degQ) [Bacillus sp. FSL R5-0286]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment