Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ17_RS15240 Genome accession   NZ_CP151975
Coordinates   2919192..2919332 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL W8-0629     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2914192..2924332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ17_RS15215 (NSQ17_15215) - 2914514..2914903 (-) 390 WP_342467566.1 hotdog fold thioesterase -
  NSQ17_RS15220 (NSQ17_15220) comA 2914927..2915568 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NSQ17_RS15225 (NSQ17_15225) comP 2915649..2917955 (-) 2307 WP_073412603.1 ATP-binding protein Regulator
  NSQ17_RS15230 (NSQ17_15230) comX 2917969..2918139 (-) 171 WP_017358941.1 competence pheromone ComX -
  NSQ17_RS15235 (NSQ17_15235) - 2918117..2919040 (-) 924 WP_008345863.1 polyprenyl synthetase family protein -
  NSQ17_RS15240 (NSQ17_15240) degQ 2919192..2919332 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSQ17_RS15245 (NSQ17_15245) - 2919838..2920191 (+) 354 WP_017367963.1 hypothetical protein -
  NSQ17_RS15250 (NSQ17_15250) - 2920228..2921454 (-) 1227 WP_342468109.1 HDOD domain-containing protein -
  NSQ17_RS15255 (NSQ17_15255) - 2921594..2923063 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  NSQ17_RS15260 (NSQ17_15260) - 2923081..2923632 (-) 552 WP_008345872.1 isochorismatase family cysteine hydrolase -
  NSQ17_RS15265 (NSQ17_15265) - 2923693..2924100 (-) 408 WP_342467567.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=982926 NSQ17_RS15240 WP_003213123.1 2919192..2919332(-) (degQ) [Bacillus sp. FSL W8-0629]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=982926 NSQ17_RS15240 WP_003213123.1 2919192..2919332(-) (degQ) [Bacillus sp. FSL W8-0629]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment