Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACN2AT_RS16380 Genome accession   NZ_CP183238
Coordinates   3146063..3146203 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NDmed     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3141063..3151203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN2AT_RS16355 (ACN2AT_16250) yuxO 3141376..3141756 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ACN2AT_RS16360 (ACN2AT_16255) comA 3141775..3142419 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACN2AT_RS16365 (ACN2AT_16260) comP 3142500..3144809 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  ACN2AT_RS16370 (ACN2AT_16265) comX 3144824..3144991 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACN2AT_RS16375 (ACN2AT_16270) comQ 3144979..3145878 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACN2AT_RS16380 (ACN2AT_16275) degQ 3146063..3146203 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACN2AT_RS16385 (ACN2AT_16280) - 3146425..3146550 (+) 126 WP_003228793.1 hypothetical protein -
  ACN2AT_RS16390 (ACN2AT_16285) - 3146664..3147032 (+) 369 WP_003243784.1 hypothetical protein -
  ACN2AT_RS16395 (ACN2AT_16290) pdeH 3147008..3148237 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACN2AT_RS16400 (ACN2AT_16295) pncB 3148374..3149846 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACN2AT_RS16405 (ACN2AT_16300) pncA 3149862..3150413 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  ACN2AT_RS16410 (ACN2AT_16305) yueI 3150510..3150908 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=982842 ACN2AT_RS16380 WP_003220708.1 3146063..3146203(-) (degQ) [Bacillus subtilis strain NDmed]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=982842 ACN2AT_RS16380 WP_003220708.1 3146063..3146203(-) (degQ) [Bacillus subtilis strain NDmed]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment