Detailed information NTG0098273

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: R8635_RS08630
• Genome accession: NZ_AP026924
• Coordinates: 1672767..1672916 (-)
• Length: 49 a.a.
• NCBI ID: WP_001820573.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain PZ900700063
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	1668554..1674181	1672767..1672916	within	0

Gene organization within MGE regions

Location: 1668554..1674181

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R8635_RS08600 (PC0062_17090)	-	1668554..1669507 (+)	954	WP_001155321.1	IS30-like element ISSpn8 family transposase	-
R8635_RS08605	-	1669597..1670208 (-)	612	WP_000394049.1	CPBP family intramembrane glutamic endopeptidase	-
R8635_RS08610 (PC0062_17100)	blpZ	1670359..1670592 (-)	234	WP_001818347.1	immunity protein BlpZ	-
R8635_RS08615 (PC0062_17110)	-	1670634..1671323 (-)	690	WP_000760510.1	CPBP family intramembrane glutamic endopeptidase	-
R8635_RS08620 (PC0062_17120)	-	1671375..1671758 (-)	384	WP_000877381.1	hypothetical protein	-
R8635_RS08625	-	1672544..1672663 (-)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
R8635_RS08630 (PC0062_17140)	cipB	1672767..1672916 (-)	150	WP_001820573.1	bacteriocin-like peptide BlpO	Regulator
R8635_RS08635 (PC0062_17150)	blpN	1673160..1673363 (-)	204	WP_001099492.1	two-peptide bacteriocin subunit BlpN	-
R8635_RS08640 (PC0062_17160)	blpM	1673379..1673633 (-)	255	WP_000379877.1	two-peptide bacteriocin subunit BlpM	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5150.91 Da
• Isoelectric Point: 3.9133

>NTDB_id=98273 R8635_RS08630 WP_001820573.1 1672767..1672916(-) (cipB) [Streptococcus pneumoniae strain PZ900700063]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=98273 R8635_RS08630 WP_001820573.1 1672767..1672916(-) (cipB) [Streptococcus pneumoniae strain PZ900700063]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51