Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MHI30_RS13085 Genome accession   NZ_CP151961
Coordinates   2615785..2615961 (+) Length   58 a.a.
NCBI ID   WP_075752367.1    Uniprot ID   -
Organism   Bacillus sp. FSL L8-0528     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2610785..2620961
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI30_RS13070 (MHI30_13070) gcvT 2611426..2612520 (-) 1095 WP_075752373.1 glycine cleavage system aminomethyltransferase GcvT -
  MHI30_RS13075 (MHI30_13075) - 2613114..2614793 (+) 1680 WP_075752371.1 SNF2-related protein -
  MHI30_RS13080 (MHI30_13080) - 2614800..2615594 (+) 795 WP_075752369.1 YqhG family protein -
  MHI30_RS13085 (MHI30_13085) sinI 2615785..2615961 (+) 177 WP_075752367.1 anti-repressor SinI family protein Regulator
  MHI30_RS13090 (MHI30_13090) sinR 2615995..2616330 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  MHI30_RS13095 (MHI30_13095) - 2616435..2617229 (-) 795 WP_075752365.1 TasA family protein -
  MHI30_RS13100 (MHI30_13100) - 2617302..2617886 (-) 585 WP_075752363.1 signal peptidase I -
  MHI30_RS13105 (MHI30_13105) tapA 2617883..2618611 (-) 729 WP_075752361.1 amyloid fiber anchoring/assembly protein TapA -
  MHI30_RS13110 (MHI30_13110) - 2618889..2619209 (+) 321 WP_075752359.1 YqzG/YhdC family protein -
  MHI30_RS13115 (MHI30_13115) - 2619239..2619421 (-) 183 WP_020452171.1 YqzE family protein -
  MHI30_RS13120 (MHI30_13120) comGG 2619510..2619875 (-) 366 WP_075752357.1 competence type IV pilus minor pilin ComGG -
  MHI30_RS13125 (MHI30_13125) comGF 2619887..2620375 (-) 489 WP_237562597.1 competence type IV pilus minor pilin ComGF -
  MHI30_RS13130 (MHI30_13130) comGE 2620284..2620631 (-) 348 WP_075752353.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6720.57 Da        Isoelectric Point: 5.0775

>NTDB_id=982262 MHI30_RS13085 WP_075752367.1 2615785..2615961(+) (sinI) [Bacillus sp. FSL L8-0528]
MNKDKNEKEELDEEWIELIKHALEQGISPEDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=982262 MHI30_RS13085 WP_075752367.1 2615785..2615961(+) (sinI) [Bacillus sp. FSL L8-0528]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGATAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment