Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKY36_RS18375 Genome accession   NZ_CP151959
Coordinates   3451821..3451961 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. FSL P2-0026     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3446821..3456961
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY36_RS18350 (MKY36_18350) - 3447092..3447481 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  MKY36_RS18355 (MKY36_18355) comA 3447498..3448136 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  MKY36_RS18360 (MKY36_18360) comP 3448223..3450544 (-) 2322 WP_026080865.1 ATP-binding protein Regulator
  MKY36_RS18365 (MKY36_18365) comX 3450584..3450748 (-) 165 WP_011198251.1 competence pheromone ComX -
  MKY36_RS18370 (MKY36_18370) - 3450763..3451632 (-) 870 WP_011198252.1 polyprenyl synthetase family protein -
  MKY36_RS18375 (MKY36_18375) degQ 3451821..3451961 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  MKY36_RS18380 (MKY36_18380) - 3452447..3452794 (+) 348 WP_009329512.1 hypothetical protein -
  MKY36_RS18385 (MKY36_18385) - 3452837..3454057 (-) 1221 WP_003184864.1 HDOD domain-containing protein -
  MKY36_RS18390 (MKY36_18390) - 3454236..3455705 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  MKY36_RS18395 (MKY36_18395) - 3455723..3456274 (-) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  MKY36_RS18400 (MKY36_18400) - 3456459..3456860 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=982175 MKY36_RS18375 WP_003184860.1 3451821..3451961(-) (degQ) [Bacillus sp. FSL P2-0026]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=982175 MKY36_RS18375 WP_003184860.1 3451821..3451961(-) (degQ) [Bacillus sp. FSL P2-0026]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment