Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSU09_RS18520 Genome accession   NZ_CP151942
Coordinates   3432921..3433061 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. PS194     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3427921..3438061
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSU09_RS18495 (NSU09_18495) - 3428198..3428578 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  NSU09_RS18500 (NSU09_18500) comA 3428597..3429241 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSU09_RS18505 (NSU09_18505) comP 3429322..3431634 (-) 2313 WP_069703660.1 histidine kinase Regulator
  NSU09_RS18510 (NSU09_18510) comX 3431650..3431871 (-) 222 WP_014480704.1 competence pheromone ComX -
  NSU09_RS18515 (NSU09_18515) - 3431873..3432736 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  NSU09_RS18520 (NSU09_18520) degQ 3432921..3433061 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSU09_RS18525 (NSU09_18525) - 3433283..3433345 (+) 63 Protein_3592 hypothetical protein -
  NSU09_RS18530 (NSU09_18530) - 3433523..3433891 (+) 369 WP_017695529.1 hypothetical protein -
  NSU09_RS18535 (NSU09_18535) pdeH 3433867..3435096 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NSU09_RS18540 (NSU09_18540) - 3435233..3436705 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSU09_RS18545 (NSU09_18545) - 3436721..3437272 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  NSU09_RS18550 (NSU09_18550) - 3437369..3437767 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=981497 NSU09_RS18520 WP_003220708.1 3432921..3433061(-) (degQ) [Bacillus sp. PS194]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=981497 NSU09_RS18520 WP_003220708.1 3432921..3433061(-) (degQ) [Bacillus sp. PS194]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment