Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AAE282_RS13385 Genome accession   NZ_CP151685
Coordinates   2556112..2556495 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain YB-187     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551112..2561495
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAE282_RS13345 (AAE282_13345) sinI 2552046..2552219 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAE282_RS13350 (AAE282_13350) sinR 2552253..2552588 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAE282_RS13355 (AAE282_13355) tasA 2552681..2553466 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  AAE282_RS13360 (AAE282_13360) sipW 2553530..2554102 (-) 573 WP_003246088.1 signal peptidase I -
  AAE282_RS13365 (AAE282_13365) tapA 2554086..2554847 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  AAE282_RS13370 (AAE282_13370) yqzG 2555119..2555445 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAE282_RS13375 (AAE282_13375) spoIIT 2555487..2555666 (-) 180 WP_003230176.1 YqzE family protein -
  AAE282_RS13380 (AAE282_13380) comGG 2555737..2556111 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AAE282_RS13385 (AAE282_13385) comGF 2556112..2556495 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AAE282_RS13390 (AAE282_13390) comGE 2556521..2556868 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AAE282_RS13395 (AAE282_13395) comGD 2556852..2557283 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AAE282_RS13400 (AAE282_13400) comGC 2557273..2557569 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AAE282_RS13405 (AAE282_13405) comGB 2557583..2558620 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  AAE282_RS13410 (AAE282_13410) comGA 2558607..2559677 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AAE282_RS13415 (AAE282_13415) corA 2560089..2561042 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=979775 AAE282_RS13385 WP_003230168.1 2556112..2556495(-) (comGF) [Bacillus subtilis strain YB-187]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=979775 AAE282_RS13385 WP_003230168.1 2556112..2556495(-) (comGF) [Bacillus subtilis strain YB-187]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment