Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilE   Type   Machinery gene
Locus tag   ACM67D_RS11135 Genome accession   NZ_CP181245
Coordinates   2122091..2122234 (-) Length   47 a.a.
NCBI ID   WP_050303184.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain LNP 16626     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2117091..2127234
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM67D_RS11115 (ACM67D_11115) pilA 2118488..2119741 (+) 1254 WP_003696286.1 signal recognition particle-docking protein FtsY Machinery gene
  ACM67D_RS11120 (ACM67D_11120) - 2120003..2120701 (-) 699 WP_416192806.1 opacity family porin -
  ACM67D_RS11125 (ACM67D_11125) - 2120724..2120855 (-) 132 WP_257736904.1 hypothetical protein -
  ACM67D_RS11130 (ACM67D_11130) pilE 2121216..2121722 (-) 507 WP_416192810.1 pilin Machinery gene
  ACM67D_RS11135 (ACM67D_11135) pilE 2122091..2122234 (-) 144 WP_050303184.1 hypothetical protein Machinery gene
  ACM67D_RS11140 (ACM67D_11140) - 2122339..2122419 (-) 81 Protein_2156 pilin -
  ACM67D_RS11145 (ACM67D_11145) - 2122537..2122959 (-) 423 Protein_2157 pilin -
  ACM67D_RS11150 (ACM67D_11150) lpxC 2123087..2124010 (-) 924 WP_003687007.1 UDP-3-O-acyl-N-acetylglucosamine deacetylase -
  ACM67D_RS11155 (ACM67D_11155) - 2124531..2124950 (-) 420 Protein_2159 pilin -
  ACM67D_RS11160 (ACM67D_11160) - 2125109..2125558 (-) 450 Protein_2160 pilin -
  ACM67D_RS11165 (ACM67D_11165) - 2125647..2126042 (-) 396 Protein_2161 pilin -
  ACM67D_RS11170 (ACM67D_11170) - 2126163..2126504 (-) 342 Protein_2162 pilin -
  ACM67D_RS11175 (ACM67D_11175) - 2126486..2126838 (-) 353 Protein_2163 pilin -
  ACM67D_RS11180 (ACM67D_11180) - 2126820..2127218 (-) 399 Protein_2164 pilin -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5006.49 Da        Isoelectric Point: 7.2429

>NTDB_id=979157 ACM67D_RS11135 WP_050303184.1 2122091..2122234(-) (pilE) [Neisseria gonorrhoeae strain LNP 16626]
MTGFNDAAGNEKIDTKHLPSTCRDKSSAGCTKHHAPISNAFQENGAF

Nucleotide


Download         Length: 144 bp        

>NTDB_id=979157 ACM67D_RS11135 WP_050303184.1 2122091..2122234(-) (pilE) [Neisseria gonorrhoeae strain LNP 16626]
ATGACGGGATTTAATGATGCCGCCGGCAACGAAAAAATCGACACCAAGCACCTGCCGTCAACCTGCCGCGATAAATCATC
TGCCGGTTGCACGAAACACCACGCGCCGATTTCAAATGCTTTCCAAGAAAACGGAGCTTTTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilE Neisseria gonorrhoeae strain FA1090

70

63.83

0.447

Multiple sequence alignment