Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37854_RS07190 | Genome accession | NZ_CP151444 |
| Coordinates | 1412745..1412924 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS37854 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1404863..1453362 | 1412745..1412924 | within | 0 |
Gene organization within MGE regions
Location: 1404863..1453362
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37854_RS07150 (MGAS37854_02934) | - | 1404863..1405297 (-) | 435 | WP_010922579.1 | CopY/TcrY family copper transport repressor | - |
| MGAS37854_RS07155 (MGAS37854_02936) | - | 1405481..1406455 (+) | 975 | WP_227869327.1 | alpha/beta hydrolase fold domain-containing protein | - |
| MGAS37854_RS07160 (MGAS37854_02938) | rbfA | 1406589..1406939 (-) | 351 | WP_002994317.1 | 30S ribosome-binding factor RbfA | - |
| MGAS37854_RS07165 (MGAS37854_02940) | infB | 1407144..1410005 (-) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| MGAS37854_RS07170 (MGAS37854_02942) | - | 1410025..1410327 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| MGAS37854_RS07175 (MGAS37854_02944) | rnpM | 1410320..1410616 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| MGAS37854_RS07180 (MGAS37854_02946) | nusA | 1410632..1411789 (-) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| MGAS37854_RS07185 (MGAS37854_02948) | rimP | 1411964..1412500 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| MGAS37854_RS07190 (MGAS37854_02950) | prx | 1412745..1412924 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS37854_RS07195 (MGAS37854_02952) | sda1 | 1413163..1414335 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS37854_RS07200 (MGAS37854_02954) | - | 1414451..1415647 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS37854_RS07205 (MGAS37854_02958) | - | 1415758..1415943 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS37854_RS07210 (MGAS37854_02960) | - | 1415940..1416239 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS37854_RS07215 (MGAS37854_02962) | - | 1416250..1416870 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS37854_RS07220 (MGAS37854_02964) | - | 1416873..1417034 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS37854_RS07225 (MGAS37854_02966) | - | 1417043..1418950 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS37854_RS07230 (MGAS37854_02968) | - | 1418961..1419596 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS37854_RS07235 (MGAS37854_02970) | - | 1419596..1420651 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS37854_RS07240 (MGAS37854_02972) | - | 1420648..1422630 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS37854_RS07245 (MGAS37854_02974) | - | 1422640..1423482 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS37854_RS07250 (MGAS37854_02976) | - | 1423494..1427876 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS37854_RS07255 (MGAS37854_02978) | - | 1427891..1428124 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS37854_RS07260 (MGAS37854_02980) | - | 1428199..1428654 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS37854_RS07265 (MGAS37854_02982) | - | 1428708..1429307 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS37854_RS07270 (MGAS37854_02984) | - | 1429319..1429678 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS37854_RS07275 (MGAS37854_02986) | - | 1429682..1430026 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS37854_RS07280 (MGAS37854_02988) | - | 1430023..1430301 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS37854_RS07285 (MGAS37854_02990) | - | 1430312..1430668 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS37854_RS07290 (MGAS37854_02992) | - | 1430680..1431567 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS37854_RS07295 (MGAS37854_02994) | - | 1431580..1432149 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS37854_RS07300 (MGAS37854_02996) | - | 1432305..1432571 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS37854_RS07305 | - | 1432574..1432762 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS37854_RS07310 (MGAS37854_03000) | - | 1432793..1434238 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS37854_RS07315 (MGAS37854_03002) | - | 1434198..1435730 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| MGAS37854_RS07320 (MGAS37854_03004) | - | 1435746..1437023 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS37854_RS07325 (MGAS37854_03006) | - | 1437013..1437465 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS37854_RS07330 (MGAS37854_03008) | - | 1437555..1437971 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS37854_RS07335 (MGAS37854_03010) | - | 1437968..1438159 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS37854_RS07340 (MGAS37854_03012) | - | 1438291..1439001 (-) | 711 | WP_050428439.1 | site-specific DNA-methyltransferase | - |
| MGAS37854_RS07345 (MGAS37854_03014) | - | 1439010..1439276 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS37854_RS07350 (MGAS37854_03016) | - | 1439273..1439440 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS37854_RS07355 (MGAS37854_03018) | - | 1439441..1440763 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS37854_RS07360 (MGAS37854_03020) | - | 1440760..1441035 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS37854_RS07365 (MGAS37854_03022) | - | 1441422..1443806 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS37854_RS07370 (MGAS37854_03024) | - | 1443811..1445733 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS37854_RS07375 (MGAS37854_03026) | - | 1445776..1446333 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS37854_RS07380 (MGAS37854_03028) | - | 1446344..1446742 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS37854_RS07385 (MGAS37854_03030) | - | 1446746..1447900 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS37854_RS07390 (MGAS37854_03032) | - | 1447900..1448199 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS37854_RS07395 (MGAS37854_03034) | - | 1448287..1448490 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS37854_RS07400 (MGAS37854_03038) | - | 1448636..1449022 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS37854_RS07405 (MGAS37854_03040) | - | 1449019..1449222 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS37854_RS07410 (MGAS37854_03042) | - | 1449215..1449385 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS37854_RS07415 (MGAS37854_03044) | - | 1449382..1449657 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS37854_RS07420 (MGAS37854_03046) | - | 1449719..1449934 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS37854_RS07425 (MGAS37854_03048) | - | 1449982..1450395 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS37854_RS07430 (MGAS37854_03050) | - | 1450376..1450531 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS37854_RS07435 (MGAS37854_03052) | - | 1450857..1451207 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS37854_RS07440 (MGAS37854_03054) | - | 1451221..1451604 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37854_RS07445 (MGAS37854_03056) | - | 1451615..1452166 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS37854_RS07450 (MGAS37854_03058) | - | 1452283..1453362 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=977164 MGAS37854_RS07190 WP_002988813.1 1412745..1412924(-) (prx) [Streptococcus pyogenes strain MGAS37854]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=977164 MGAS37854_RS07190 WP_002988813.1 1412745..1412924(-) (prx) [Streptococcus pyogenes strain MGAS37854]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |