Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACK2OW_RS03305 Genome accession   NZ_CP180575
Coordinates   564512..564685 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain K3C     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 559512..569685
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK2OW_RS03290 (ACK2OW_03290) gcvT 560310..561398 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  ACK2OW_RS03295 (ACK2OW_03295) hepAA 561840..563513 (+) 1674 WP_032726152.1 DEAD/DEAH box helicase -
  ACK2OW_RS03300 (ACK2OW_03300) yqhG 563534..564328 (+) 795 WP_032726154.1 YqhG family protein -
  ACK2OW_RS03305 (ACK2OW_03305) sinI 564512..564685 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  ACK2OW_RS03310 (ACK2OW_03310) sinR 564719..565054 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACK2OW_RS03315 (ACK2OW_03315) tasA 565146..565931 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  ACK2OW_RS03320 (ACK2OW_03320) sipW 565996..566568 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACK2OW_RS03325 (ACK2OW_03325) tapA 566552..567313 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  ACK2OW_RS03330 (ACK2OW_03330) yqzG 567584..567910 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  ACK2OW_RS03335 (ACK2OW_03335) spoIITA 567952..568131 (-) 180 WP_014480252.1 YqzE family protein -
  ACK2OW_RS03340 (ACK2OW_03340) comGG 568203..568577 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  ACK2OW_RS03345 (ACK2OW_03345) comGF 568578..568961 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  ACK2OW_RS03350 (ACK2OW_03350) comGE 568987..569334 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=974950 ACK2OW_RS03305 WP_014477323.1 564512..564685(+) (sinI) [Bacillus subtilis strain K3C]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=974950 ACK2OW_RS03305 WP_014477323.1 564512..564685(+) (sinI) [Bacillus subtilis strain K3C]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982