Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8474_RS07630 Genome accession   NZ_AP026914
Coordinates   1507876..1508025 (-) Length   49 a.a.
NCBI ID   WP_001820573.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900700003     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 1508814..1509699 1507876..1508025 flank 789


Gene organization within MGE regions


Location: 1507876..1509699
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8474_RS07630 (PC0003_15110) cipB 1507876..1508025 (-) 150 WP_001820573.1 bacteriocin-like peptide BlpO Regulator
  R8474_RS07635 (PC0003_15120) blpN 1508269..1508472 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R8474_RS07640 (PC0003_15130) blpM 1508488..1508742 (-) 255 WP_000379877.1 two-peptide bacteriocin subunit BlpM -
  R8474_RS07645 - 1508895..1509699 (-) 805 Protein_1514 IS5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.91 Da        Isoelectric Point: 3.9133

>NTDB_id=97495 R8474_RS07630 WP_001820573.1 1507876..1508025(-) (cipB) [Streptococcus pneumoniae strain PZ900700003]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=97495 R8474_RS07630 WP_001820573.1 1507876..1508025(-) (cipB) [Streptococcus pneumoniae strain PZ900700003]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment