Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WF295_RS17235 Genome accession   NZ_CP150885
Coordinates   3407536..3407676 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain Baplich1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3402536..3412676
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WF295_RS17210 (WF295_17210) - 3402829..3403218 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  WF295_RS17215 (WF295_17215) comA 3403235..3403873 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  WF295_RS17220 (WF295_17220) comP 3403960..3406275 (-) 2316 WP_020452789.1 ATP-binding protein Regulator
  WF295_RS17225 (WF295_17225) comX 3406296..3406466 (-) 171 WP_020452790.1 competence pheromone ComX -
  WF295_RS17230 (WF295_17230) - 3406438..3407349 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  WF295_RS17235 (WF295_17235) degQ 3407536..3407676 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  WF295_RS17240 (WF295_17240) - 3408162..3408509 (+) 348 WP_223254849.1 hypothetical protein -
  WF295_RS17245 (WF295_17245) - 3408552..3409772 (-) 1221 WP_020452793.1 HDOD domain-containing protein -
  WF295_RS17250 (WF295_17250) - 3409950..3411419 (-) 1470 WP_020452794.1 nicotinate phosphoribosyltransferase -
  WF295_RS17255 (WF295_17255) - 3411437..3411988 (-) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  WF295_RS17260 (WF295_17260) - 3412174..3412575 (-) 402 WP_039072963.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=973435 WF295_RS17235 WP_003184860.1 3407536..3407676(-) (degQ) [Bacillus paralicheniformis strain Baplich1]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=973435 WF295_RS17235 WP_003184860.1 3407536..3407676(-) (degQ) [Bacillus paralicheniformis strain Baplich1]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment