Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | WNC56_RS09040 | Genome accession | NZ_CP150833 |
| Coordinates | 1798100..1798480 (+) | Length | 126 a.a. |
| NCBI ID | WP_044335941.1 | Uniprot ID | A0AAP7UKB4 |
| Organism | Bacillus safensis strain DMB13 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1764917..1802894 | 1798100..1798480 | within | 0 |
Gene organization within MGE regions
Location: 1764917..1802894
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WNC56_RS08875 (WNC56_08865) | - | 1764917..1765756 (+) | 840 | WP_024424079.1 | hypothetical protein | - |
| WNC56_RS08880 (WNC56_08870) | - | 1765801..1766182 (+) | 382 | Protein_1701 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WNC56_RS08885 (WNC56_08875) | - | 1766312..1767897 (+) | 1586 | Protein_1702 | ribonuclease YeeF family protein | - |
| WNC56_RS08890 (WNC56_08880) | - | 1767902..1768285 (+) | 384 | WP_024425095.1 | immunity 22 family protein | - |
| WNC56_RS08895 (WNC56_08885) | - | 1768359..1768763 (+) | 405 | WP_024425096.1 | hypothetical protein | - |
| WNC56_RS08900 (WNC56_08890) | - | 1769229..1769411 (+) | 183 | WP_073980085.1 | hypothetical protein | - |
| WNC56_RS08905 (WNC56_08895) | - | 1769503..1769847 (+) | 345 | WP_024425098.1 | hypothetical protein | - |
| WNC56_RS08910 (WNC56_08900) | - | 1770166..1770534 (+) | 369 | WP_024425099.1 | nuclear transport factor 2 family protein | - |
| WNC56_RS08915 (WNC56_08905) | - | 1770913..1772004 (+) | 1092 | WP_044335959.1 | Rap family tetratricopeptide repeat protein | - |
| WNC56_RS08920 (WNC56_08910) | - | 1772007..1772141 (+) | 135 | WP_259279673.1 | hypothetical protein | - |
| WNC56_RS08925 (WNC56_08915) | - | 1772265..1774193 (+) | 1929 | WP_270125055.1 | T7SS effector LXG polymorphic toxin | - |
| WNC56_RS08930 (WNC56_08920) | - | 1774197..1774682 (+) | 486 | WP_103132382.1 | immunity protein YezG family protein | - |
| WNC56_RS08935 (WNC56_08925) | - | 1774856..1775581 (+) | 726 | WP_122631424.1 | DNA/RNA non-specific endonuclease | - |
| WNC56_RS08940 (WNC56_08930) | - | 1775588..1776064 (+) | 477 | WP_103132505.1 | immunity protein YezG family protein | - |
| WNC56_RS08945 (WNC56_08935) | - | 1776128..1776589 (-) | 462 | WP_044335609.1 | macro domain-containing protein | - |
| WNC56_RS08950 (WNC56_08940) | - | 1776818..1777399 (+) | 582 | WP_103132504.1 | undecaprenyl-diphosphatase | - |
| WNC56_RS08955 (WNC56_08945) | - | 1777449..1777820 (-) | 372 | WP_103132503.1 | iron chaperone | - |
| WNC56_RS08960 (WNC56_08950) | - | 1778363..1779475 (+) | 1113 | WP_103132502.1 | tetratricopeptide repeat protein | - |
| WNC56_RS08965 (WNC56_08955) | - | 1780204..1780899 (-) | 696 | WP_103132512.1 | YoaK family protein | - |
| WNC56_RS08970 (WNC56_08960) | - | 1780967..1782799 (-) | 1833 | WP_103132501.1 | DNA ligase D | - |
| WNC56_RS08975 (WNC56_08965) | - | 1782915..1783763 (+) | 849 | WP_024425113.1 | Ku protein | - |
| WNC56_RS08980 (WNC56_08970) | - | 1783787..1784230 (-) | 444 | WP_041109183.1 | DUF2188 domain-containing protein | - |
| WNC56_RS08985 (WNC56_08975) | - | 1784391..1784864 (+) | 474 | WP_052503034.1 | VOC family protein | - |
| WNC56_RS08990 (WNC56_08980) | - | 1784913..1785326 (+) | 414 | WP_103132500.1 | Rrf2 family transcriptional regulator | - |
| WNC56_RS08995 (WNC56_08985) | - | 1785427..1786278 (+) | 852 | WP_103132499.1 | SDR family oxidoreductase | - |
| WNC56_RS09000 (WNC56_08990) | - | 1786433..1787341 (+) | 909 | WP_103132498.1 | DMT family transporter | - |
| WNC56_RS09005 (WNC56_08995) | - | 1787354..1787545 (-) | 192 | WP_044335590.1 | TIGR00366 family protein | - |
| WNC56_RS09010 (WNC56_09000) | - | 1787656..1789872 (+) | 2217 | WP_406846170.1 | RNA ligase | - |
| WNC56_RS09015 (WNC56_09005) | - | 1789937..1790647 (+) | 711 | WP_044335586.1 | DUF421 domain-containing protein | - |
| WNC56_RS09020 (WNC56_09010) | - | 1790875..1791453 (+) | 579 | WP_041109214.1 | TetR/AcrR family transcriptional regulator | - |
| WNC56_RS09025 (WNC56_09015) | - | 1791476..1794619 (+) | 3144 | WP_151039502.1 | bifunctional cytochrome P450/NADPH--P450 reductase | - |
| WNC56_RS09030 (WNC56_09020) | - | 1794813..1795721 (+) | 909 | WP_151039503.1 | serine protease | - |
| WNC56_RS09035 (WNC56_09025) | - | 1795868..1797874 (+) | 2007 | WP_151039504.1 | glycosyltransferase family 39 protein | - |
| WNC56_RS09040 (WNC56_09030) | nucA/comI | 1798100..1798480 (+) | 381 | WP_044335941.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
| WNC56_RS09045 (WNC56_09035) | - | 1798626..1799474 (+) | 849 | WP_103132493.1 | STAS domain-containing protein | - |
| WNC56_RS09050 (WNC56_09040) | - | 1799508..1800050 (-) | 543 | WP_041109224.1 | IseA DL-endopeptidase inhibitor family protein | - |
| WNC56_RS09055 (WNC56_09045) | - | 1800345..1800794 (+) | 450 | WP_073205718.1 | hypothetical protein | - |
| WNC56_RS09060 (WNC56_09050) | lexA | 1800839..1801459 (-) | 621 | WP_024425129.1 | transcriptional repressor LexA | - |
| WNC56_RS09065 (WNC56_09055) | yneA | 1801618..1801929 (+) | 312 | WP_024425130.1 | cell division suppressor protein YneA | - |
| WNC56_RS09070 (WNC56_09060) | - | 1801947..1802594 (+) | 648 | WP_103132492.1 | recombinase family protein | - |
| WNC56_RS09075 (WNC56_09065) | - | 1802664..1802894 (+) | 231 | WP_024425132.1 | DUF896 domain-containing protein | - |
Sequence
Protein
Download Length: 126 a.a. Molecular weight: 13727.41 Da Isoelectric Point: 8.5068
>NTDB_id=972779 WNC56_RS09040 WP_044335941.1 1798100..1798480(+) (nucA/comI) [Bacillus safensis strain DMB13]
MGTLLGGFGEKQAAKGADRYDHVVQFPKERYPETGSHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISGFPDGKRILFIVK
MGTLLGGFGEKQAAKGADRYDHVVQFPKERYPETGSHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISGFPDGKRILFIVK
Nucleotide
Download Length: 381 bp
>NTDB_id=972779 WNC56_RS09040 WP_044335941.1 1798100..1798480(+) (nucA/comI) [Bacillus safensis strain DMB13]
ATGGGCACGTTGTTAGGTGGATTTGGAGAGAAGCAGGCAGCAAAAGGGGCTGATCGATATGATCATGTCGTTCAATTTCC
AAAGGAAAGGTACCCTGAAACAGGCAGTCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACCATTGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACAAAACCTGGCTTTGACCGGGATGAATGGCCA
ATGGCAGTTTGTCTTGAGGGAGGAAAAGGCGCAAGCGTACAATATGTCAGTCCATCTGATAATAGGGGAGCAGGCTCATG
GGTCGGGCATCAAATCAGCGGGTTTCCTGATGGGAAAAGAATATTATTCATTGTGAAATAA
ATGGGCACGTTGTTAGGTGGATTTGGAGAGAAGCAGGCAGCAAAAGGGGCTGATCGATATGATCATGTCGTTCAATTTCC
AAAGGAAAGGTACCCTGAAACAGGCAGTCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACCATTGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACAAAACCTGGCTTTGACCGGGATGAATGGCCA
ATGGCAGTTTGTCTTGAGGGAGGAAAAGGCGCAAGCGTACAATATGTCAGTCCATCTGATAATAGGGGAGCAGGCTCATG
GGTCGGGCATCAAATCAGCGGGTTTCCTGATGGGAAAAGAATATTATTCATTGTGAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
57.983 |
94.444 |
0.548 |