Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACLII2_RS04945 Genome accession   NZ_CP178213
Coordinates   960192..960332 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain BM107     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 955192..965332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLII2_RS04915 yueI 955487..955885 (+) 399 WP_003242987.1 YueI family protein -
  ACLII2_RS04920 pncA 955982..956533 (+) 552 WP_003243099.1 cysteine hydrolase family protein -
  ACLII2_RS04925 pncB 956549..958021 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACLII2_RS04930 pdeH 958158..959387 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACLII2_RS04935 - 959363..959731 (-) 369 WP_003243784.1 hypothetical protein -
  ACLII2_RS04940 - 959845..959970 (-) 126 WP_003228793.1 hypothetical protein -
  ACLII2_RS04945 degQ 960192..960332 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLII2_RS04950 comQ 960517..961416 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACLII2_RS04955 comX 961404..961571 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACLII2_RS04960 comP 961586..963894 (+) 2309 Protein_985 two-component system sensor histidine kinase ComP -
  ACLII2_RS04965 comA 963975..964619 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLII2_RS04970 yuxO 964638..965018 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=970743 ACLII2_RS04945 WP_003220708.1 960192..960332(+) (degQ) [Bacillus subtilis subsp. subtilis strain BM107]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=970743 ACLII2_RS04945 WP_003220708.1 960192..960332(+) (degQ) [Bacillus subtilis subsp. subtilis strain BM107]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1