Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHH77_RS14510 Genome accession   NZ_CP150435
Coordinates   2826939..2827079 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-2837     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2821939..2832079
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH77_RS14485 (MHH77_14485) - 2822205..2822594 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  MHH77_RS14490 (MHH77_14490) comA 2822618..2823259 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  MHH77_RS14495 (MHH77_14495) comP 2823340..2825652 (-) 2313 WP_339163736.1 ATP-binding protein Regulator
  MHH77_RS14500 (MHH77_14500) comX 2825706..2825876 (-) 171 WP_098677614.1 competence pheromone ComX -
  MHH77_RS14505 (MHH77_14505) - 2825873..2826787 (-) 915 WP_339163738.1 polyprenyl synthetase family protein -
  MHH77_RS14510 (MHH77_14510) degQ 2826939..2827079 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHH77_RS14515 (MHH77_14515) - 2827585..2827938 (+) 354 WP_034620108.1 hypothetical protein -
  MHH77_RS14520 (MHH77_14520) - 2827970..2829196 (-) 1227 WP_012011110.1 HDOD domain-containing protein -
  MHH77_RS14525 (MHH77_14525) - 2829336..2830805 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  MHH77_RS14530 (MHH77_14530) - 2830823..2831374 (-) 552 WP_144461867.1 isochorismatase family cysteine hydrolase -
  MHH77_RS14535 (MHH77_14535) - 2831435..2831842 (-) 408 WP_144461864.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=970313 MHH77_RS14510 WP_003213123.1 2826939..2827079(-) (degQ) [Bacillus sp. FSL K6-2837]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=970313 MHH77_RS14510 WP_003213123.1 2826939..2827079(-) (degQ) [Bacillus sp. FSL K6-2837]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment