Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHB78_RS05865 Genome accession   NZ_CP150286
Coordinates   1068938..1069078 (+) Length   46 a.a.
NCBI ID   WP_046131692.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-0138     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1063938..1074078
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB78_RS05840 (MHB78_05840) - 1064107..1064499 (+) 393 WP_046131696.1 YueI family protein -
  MHB78_RS05845 (MHB78_05845) - 1064637..1065188 (+) 552 WP_046131695.1 cysteine hydrolase family protein -
  MHB78_RS05850 (MHB78_05850) - 1065206..1066675 (+) 1470 WP_046131694.1 nicotinate phosphoribosyltransferase -
  MHB78_RS05855 (MHB78_05855) - 1066830..1068047 (+) 1218 WP_046131693.1 HDOD domain-containing protein -
  MHB78_RS05860 (MHB78_05860) - 1068098..1068445 (-) 348 WP_231947384.1 hypothetical protein -
  MHB78_RS05865 (MHB78_05865) degQ 1068938..1069078 (+) 141 WP_046131692.1 degradation enzyme regulation protein DegQ Regulator
  MHB78_RS05870 (MHB78_05870) - 1069268..1070140 (+) 873 WP_046131716.1 polyprenyl synthetase family protein -
  MHB78_RS05875 (MHB78_05875) comX 1070151..1070315 (+) 165 WP_046131691.1 competence pheromone ComX -
  MHB78_RS05880 (MHB78_05880) comP 1070356..1072674 (+) 2319 WP_046131690.1 ATP-binding protein Regulator
  MHB78_RS05885 (MHB78_05885) comA 1072757..1073395 (+) 639 WP_046131689.1 response regulator transcription factor Regulator
  MHB78_RS05890 (MHB78_05890) - 1073415..1073807 (+) 393 WP_046131688.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5733.54 Da        Isoelectric Point: 8.4596

>NTDB_id=969528 MHB78_RS05865 WP_046131692.1 1068938..1069078(+) (degQ) [Bacillus sp. FSL K6-0138]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYSYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=969528 MHB78_RS05865 WP_046131692.1 1068938..1069078(+) (degQ) [Bacillus sp. FSL K6-0138]
GTGGAAAAGCAACAAATTGAAGAGTTAAAGCAATTGCTTTGGCGGCTTGAAAATGAAATCAGGGAAACGAAAGACTCCTT
GCGCAAGATTAACAAAAGTATCGACCAATATGATAAATACTCATATTTAAAAACCTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment