Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHB62_RS16430 Genome accession   NZ_CP150278
Coordinates   3136860..3137000 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL K6-0255     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3131860..3142000
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB62_RS16405 (MHB62_16400) - 3132137..3132517 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MHB62_RS16410 (MHB62_16405) comA 3132536..3133180 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MHB62_RS16415 (MHB62_16410) comP 3133261..3135573 (-) 2313 WP_032722435.1 histidine kinase Regulator
  MHB62_RS16420 (MHB62_16415) comX 3135589..3135810 (-) 222 WP_014480704.1 competence pheromone ComX -
  MHB62_RS16425 (MHB62_16420) - 3135812..3136675 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  MHB62_RS16430 (MHB62_16425) degQ 3136860..3137000 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MHB62_RS16435 (MHB62_16430) - 3137222..3137347 (+) 126 WP_003228793.1 hypothetical protein -
  MHB62_RS16440 (MHB62_16435) - 3137461..3137829 (+) 369 WP_014477834.1 hypothetical protein -
  MHB62_RS16445 (MHB62_16440) pdeH 3137805..3139034 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MHB62_RS16450 (MHB62_16445) - 3139171..3140643 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MHB62_RS16455 (MHB62_16450) - 3140659..3141210 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  MHB62_RS16460 (MHB62_16455) - 3141307..3141705 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=969286 MHB62_RS16430 WP_003220708.1 3136860..3137000(-) (degQ) [Bacillus sp. FSL K6-0255]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=969286 MHB62_RS16430 WP_003220708.1 3136860..3137000(-) (degQ) [Bacillus sp. FSL K6-0255]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment