Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | MHH52_RS21675 | Genome accession | NZ_CP150276 |
| Coordinates | 4581132..4581563 (+) | Length | 143 a.a. |
| NCBI ID | WP_340009765.1 | Uniprot ID | - |
| Organism | Paenibacillus sp. FSL K6-0276 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4575739..4629535 | 4581132..4581563 | within | 0 |
| IScluster/Tn | 4578874..4580234 | 4581132..4581563 | flank | 898 |
Gene organization within MGE regions
Location: 4575739..4629535
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MHH52_RS21640 (MHH52_21640) | - | 4575739..4576425 (-) | 687 | WP_340004394.1 | M15 family metallopeptidase | - |
| MHH52_RS21645 (MHH52_21645) | - | 4576720..4576884 (+) | 165 | WP_167348532.1 | hypothetical protein | - |
| MHH52_RS21650 (MHH52_21650) | - | 4576881..4577207 (-) | 327 | WP_340004395.1 | YolD-like family protein | - |
| MHH52_RS21655 (MHH52_21655) | - | 4577460..4578020 (-) | 561 | WP_340004396.1 | hypothetical protein | - |
| MHH52_RS21660 (MHH52_21660) | - | 4578138..4578626 (+) | 489 | WP_340004397.1 | PH domain-containing protein | - |
| MHH52_RS21670 (MHH52_21670) | - | 4580608..4581024 (-) | 417 | WP_340009764.1 | cytidine deaminase | - |
| MHH52_RS21675 (MHH52_21675) | nucA/comI | 4581132..4581563 (+) | 432 | WP_340009765.1 | NucA/NucB deoxyribonuclease domain-containing protein | Machinery gene |
| MHH52_RS21680 (MHH52_21680) | - | 4581652..4581798 (-) | 147 | WP_313641762.1 | YjcZ family sporulation protein | - |
| MHH52_RS21685 (MHH52_21685) | - | 4581948..4582124 (+) | 177 | WP_313641753.1 | YjfB family protein | - |
| MHH52_RS21690 (MHH52_21690) | - | 4582273..4582815 (+) | 543 | WP_340004398.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MHH52_RS21695 (MHH52_21695) | - | 4582895..4583056 (+) | 162 | WP_170880221.1 | hypothetical protein | - |
| MHH52_RS21700 (MHH52_21700) | - | 4583123..4583260 (-) | 138 | WP_340004399.1 | hypothetical protein | - |
| MHH52_RS21705 (MHH52_21705) | - | 4583370..4583702 (+) | 333 | WP_340004400.1 | DUF3139 domain-containing protein | - |
| MHH52_RS21710 (MHH52_21710) | - | 4583877..4584371 (+) | 495 | WP_313641757.1 | sigma-70 family RNA polymerase sigma factor | - |
| MHH52_RS21715 (MHH52_21715) | - | 4584368..4585357 (+) | 990 | WP_340004401.1 | hypothetical protein | - |
| MHH52_RS21725 (MHH52_21725) | - | 4586515..4587366 (-) | 852 | WP_340004402.1 | DUF3037 domain-containing protein | - |
| MHH52_RS21730 (MHH52_21730) | - | 4587369..4588184 (-) | 816 | WP_340004403.1 | HipA family kinase | - |
| MHH52_RS21735 (MHH52_21735) | - | 4588565..4588984 (+) | 420 | WP_340004404.1 | stress protein | - |
| MHH52_RS21740 (MHH52_21740) | - | 4589042..4589287 (-) | 246 | WP_340004405.1 | YolD-like family protein | - |
| MHH52_RS21745 (MHH52_21745) | - | 4589395..4589703 (-) | 309 | WP_340004406.1 | hypothetical protein | - |
| MHH52_RS21750 (MHH52_21750) | - | 4589837..4590103 (+) | 267 | WP_340004407.1 | hypothetical protein | - |
| MHH52_RS21755 (MHH52_21755) | - | 4590157..4590891 (-) | 735 | WP_340004408.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MHH52_RS21760 (MHH52_21760) | - | 4590891..4591157 (-) | 267 | WP_340004409.1 | phage holin family protein | - |
| MHH52_RS21765 (MHH52_21765) | - | 4591180..4591401 (-) | 222 | WP_340004410.1 | BhlA/UviB family holin-like peptide | - |
| MHH52_RS21770 (MHH52_21770) | - | 4591463..4591594 (-) | 132 | WP_340004411.1 | XkdX family protein | - |
| MHH52_RS21775 (MHH52_21775) | - | 4591595..4592077 (-) | 483 | WP_340004412.1 | XkdW family protein | - |
| MHH52_RS21780 (MHH52_21780) | - | 4592093..4594033 (-) | 1941 | WP_340004413.1 | hypothetical protein | - |
| MHH52_RS21785 (MHH52_21785) | - | 4594046..4594690 (-) | 645 | WP_340004414.1 | hypothetical protein | - |
| MHH52_RS21790 (MHH52_21790) | - | 4594683..4595858 (-) | 1176 | WP_340004415.1 | baseplate J/gp47 family protein | - |
| MHH52_RS21795 (MHH52_21795) | - | 4595848..4596213 (-) | 366 | WP_340004416.1 | DUF2634 domain-containing protein | - |
| MHH52_RS21800 (MHH52_21800) | - | 4596201..4596536 (-) | 336 | WP_340004417.1 | Gp138 family membrane-puncturing spike protein | - |
| MHH52_RS21805 (MHH52_21805) | - | 4596611..4597405 (-) | 795 | WP_340004418.1 | hypothetical protein | - |
| MHH52_RS21810 (MHH52_21810) | - | 4597398..4597718 (-) | 321 | WP_340004419.1 | hypothetical protein | - |
| MHH52_RS21815 (MHH52_21815) | - | 4597722..4598288 (-) | 567 | WP_340004420.1 | phage baseplate protein | - |
| MHH52_RS21820 (MHH52_21820) | - | 4598242..4600767 (-) | 2526 | WP_340004421.1 | phage tail tape measure protein | - |
| MHH52_RS21825 (MHH52_21825) | - | 4600813..4601007 (-) | 195 | WP_340004422.1 | hypothetical protein | - |
| MHH52_RS21830 (MHH52_21830) | - | 4600991..4601281 (-) | 291 | WP_340004423.1 | hypothetical protein | - |
| MHH52_RS21835 (MHH52_21835) | - | 4601313..4601711 (-) | 399 | WP_340004424.1 | phage protein | - |
| MHH52_RS21840 (MHH52_21840) | - | 4601724..4602749 (-) | 1026 | WP_340004425.1 | DUF3383 family protein | - |
| MHH52_RS21845 (MHH52_21845) | - | 4602736..4603233 (-) | 498 | WP_340004426.1 | hypothetical protein | - |
| MHH52_RS21850 (MHH52_21850) | - | 4603567..4604043 (-) | 477 | WP_340004427.1 | hypothetical protein | - |
| MHH52_RS21855 (MHH52_21855) | - | 4604043..4604594 (-) | 552 | WP_340004428.1 | phage gp6-like head-tail connector protein | - |
| MHH52_RS21860 (MHH52_21860) | - | 4604594..4605769 (-) | 1176 | WP_340004429.1 | phage major capsid protein | - |
| MHH52_RS21865 (MHH52_21865) | - | 4605814..4606413 (-) | 600 | WP_340004430.1 | HK97 family phage prohead protease | - |
| MHH52_RS21870 (MHH52_21870) | - | 4606422..4607702 (-) | 1281 | WP_340004431.1 | phage portal protein | - |
| MHH52_RS21875 (MHH52_21875) | - | 4607717..4609507 (-) | 1791 | WP_340004432.1 | terminase TerL endonuclease subunit | - |
| MHH52_RS21880 (MHH52_21880) | - | 4609488..4609970 (-) | 483 | WP_340004433.1 | phage terminase small subunit P27 family | - |
| MHH52_RS21885 (MHH52_21885) | - | 4610129..4611106 (-) | 978 | WP_340004434.1 | hypothetical protein | - |
| MHH52_RS21890 (MHH52_21890) | - | 4611185..4611541 (-) | 357 | WP_340004435.1 | HNH endonuclease | - |
| MHH52_RS21895 (MHH52_21895) | - | 4611708..4612256 (-) | 549 | WP_340004436.1 | site-specific integrase | - |
| MHH52_RS21900 (MHH52_21900) | - | 4612253..4612402 (-) | 150 | WP_340004437.1 | hypothetical protein | - |
| MHH52_RS21905 (MHH52_21905) | - | 4613030..4613410 (-) | 381 | WP_340004438.1 | hypothetical protein | - |
| MHH52_RS21910 (MHH52_21910) | - | 4613498..4613734 (-) | 237 | WP_340004439.1 | hypothetical protein | - |
| MHH52_RS21915 (MHH52_21915) | - | 4614015..4614959 (-) | 945 | WP_340004440.1 | DUF3102 domain-containing protein | - |
| MHH52_RS21920 (MHH52_21920) | - | 4614956..4616515 (-) | 1560 | WP_340004441.1 | PcfJ domain-containing protein | - |
| MHH52_RS21925 (MHH52_21925) | - | 4616528..4616905 (-) | 378 | WP_340004442.1 | hypothetical protein | - |
| MHH52_RS21930 (MHH52_21930) | dnaB | 4616927..4618285 (-) | 1359 | WP_340004443.1 | replicative DNA helicase | - |
| MHH52_RS21935 (MHH52_21935) | - | 4618251..4618601 (-) | 351 | WP_340004444.1 | hypothetical protein | - |
| MHH52_RS21940 (MHH52_21940) | - | 4618579..4619538 (-) | 960 | WP_340004445.1 | hypothetical protein | - |
| MHH52_RS21945 (MHH52_21945) | - | 4619560..4619748 (-) | 189 | WP_340004446.1 | hypothetical protein | - |
| MHH52_RS21950 (MHH52_21950) | - | 4619760..4620065 (-) | 306 | WP_340004447.1 | hypothetical protein | - |
| MHH52_RS21955 (MHH52_21955) | - | 4620222..4620431 (-) | 210 | WP_340004448.1 | hypothetical protein | - |
| MHH52_RS21960 (MHH52_21960) | - | 4620421..4620720 (-) | 300 | WP_340004449.1 | hypothetical protein | - |
| MHH52_RS21965 (MHH52_21965) | - | 4620730..4621245 (-) | 516 | WP_340004450.1 | XRE family transcriptional regulator | - |
| MHH52_RS21970 (MHH52_21970) | - | 4621377..4621679 (-) | 303 | WP_340004451.1 | hypothetical protein | - |
| MHH52_RS21975 (MHH52_21975) | - | 4621682..4621933 (-) | 252 | WP_340004452.1 | helix-turn-helix transcriptional regulator | - |
| MHH52_RS21980 (MHH52_21980) | - | 4622060..4622458 (+) | 399 | WP_340004453.1 | helix-turn-helix transcriptional regulator | - |
| MHH52_RS21985 (MHH52_21985) | - | 4622536..4623411 (+) | 876 | WP_340004454.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MHH52_RS21990 (MHH52_21990) | - | 4623492..4624643 (+) | 1152 | WP_340004455.1 | tyrosine-type recombinase/integrase | - |
| MHH52_RS22005 (MHH52_22005) | - | 4625031..4625195 (-) | 165 | WP_019909365.1 | hypothetical protein | - |
| MHH52_RS22010 (MHH52_22010) | - | 4625308..4626792 (-) | 1485 | WP_340004456.1 | extracellular solute-binding protein | - |
| MHH52_RS22015 (MHH52_22015) | - | 4627241..4628446 (-) | 1206 | WP_340004457.1 | IS4 family transposase | - |
| MHH52_RS22020 (MHH52_22020) | pyrE | 4628897..4629535 (-) | 639 | WP_340004458.1 | orotate phosphoribosyltransferase | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 15886.76 Da Isoelectric Point: 4.4812
>NTDB_id=969168 MHH52_RS21675 WP_340009765.1 4581132..4581563(+) (nucA/comI) [Paenibacillus sp. FSL K6-0276]
MQKFITSLIIVVLLALSGYWFEQNGDPAAPSSTSDSEVVQLTFPSDRYPETAKHIQDAIAKGESATCTINREQAEENRKE
SLKGIPTKKGYDRDEWPMAMCDEGGKGADIEYITPKDNRGAGSWVGNQLEVYADGTRVEFMFK
MQKFITSLIIVVLLALSGYWFEQNGDPAAPSSTSDSEVVQLTFPSDRYPETAKHIQDAIAKGESATCTINREQAEENRKE
SLKGIPTKKGYDRDEWPMAMCDEGGKGADIEYITPKDNRGAGSWVGNQLEVYADGTRVEFMFK
Nucleotide
Download Length: 432 bp
>NTDB_id=969168 MHH52_RS21675 WP_340009765.1 4581132..4581563(+) (nucA/comI) [Paenibacillus sp. FSL K6-0276]
ATACAGAAATTTATCACCAGTCTCATCATTGTTGTGTTACTTGCCTTGAGCGGTTACTGGTTTGAACAGAACGGAGACCC
GGCAGCCCCCTCGTCTACATCCGATTCAGAAGTTGTTCAGCTGACCTTCCCATCGGATCGTTATCCTGAGACCGCCAAGC
ATATTCAGGATGCGATTGCCAAAGGGGAATCCGCCACGTGCACCATTAACCGTGAGCAGGCTGAAGAGAACCGCAAAGAA
TCCTTAAAAGGGATCCCCACCAAAAAAGGGTACGACCGCGATGAATGGCCAATGGCCATGTGTGATGAAGGCGGCAAAGG
TGCCGACATTGAATACATAACCCCCAAAGATAACCGCGGTGCAGGAAGCTGGGTTGGTAATCAGCTAGAAGTTTATGCGG
ATGGAACCCGCGTAGAATTTATGTTCAAATAA
ATACAGAAATTTATCACCAGTCTCATCATTGTTGTGTTACTTGCCTTGAGCGGTTACTGGTTTGAACAGAACGGAGACCC
GGCAGCCCCCTCGTCTACATCCGATTCAGAAGTTGTTCAGCTGACCTTCCCATCGGATCGTTATCCTGAGACCGCCAAGC
ATATTCAGGATGCGATTGCCAAAGGGGAATCCGCCACGTGCACCATTAACCGTGAGCAGGCTGAAGAGAACCGCAAAGAA
TCCTTAAAAGGGATCCCCACCAAAAAAGGGTACGACCGCGATGAATGGCCAATGGCCATGTGTGATGAAGGCGGCAAAGG
TGCCGACATTGAATACATAACCCCCAAAGATAACCGCGGTGCAGGAAGCTGGGTTGGTAATCAGCTAGAAGTTTATGCGG
ATGGAACCCGCGTAGAATTTATGTTCAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
67.961 |
72.028 |
0.49 |