Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   MHI44_RS03500 Genome accession   NZ_CP150268
Coordinates   648974..649384 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus sp. FSL K6-1366     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 644340..667515 648974..649384 within 0


Gene organization within MGE regions


Location: 644340..667515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI44_RS03475 (MHI44_03475) - 644507..645238 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  MHI44_RS03480 (MHI44_03480) cwlH 645490..646242 (-) 753 WP_015251672.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  MHI44_RS03485 (MHI44_03485) - 646429..647055 (+) 627 WP_101172378.1 TVP38/TMEM64 family protein -
  MHI44_RS03490 (MHI44_03490) gnd 647074..647967 (-) 894 WP_217011418.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  MHI44_RS03495 (MHI44_03495) - 648219..648941 (+) 723 WP_010886572.1 hypothetical protein -
  MHI44_RS03500 (MHI44_03500) nucA/comI 648974..649384 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  MHI44_RS03505 (MHI44_03505) - 649580..649924 (+) 345 Protein_696 sigma-70 family RNA polymerase sigma factor -
  MHI44_RS03510 (MHI44_03510) - 650070..650540 (+) 471 WP_339202879.1 MarR family transcriptional regulator -
  MHI44_RS03515 (MHI44_03515) - 650691..652103 (+) 1413 WP_339202881.1 MDR family MFS transporter -
  MHI44_RS03520 (MHI44_03520) spoIVCA 652289..653749 (-) 1461 WP_339203511.1 site-specific DNA recombinase SpoIVCA -
  MHI44_RS03525 (MHI44_03525) - 653707..653885 (-) 179 Protein_700 hypothetical protein -
  MHI44_RS03530 (MHI44_03530) - 654542..655639 (-) 1098 WP_339202883.1 glycosyl hydrolase -
  MHI44_RS03535 (MHI44_03535) - 656474..657604 (-) 1131 WP_106073588.1 hypothetical protein -
  MHI44_RS03540 (MHI44_03540) - 657921..658454 (-) 534 WP_076458142.1 hypothetical protein -
  MHI44_RS03545 (MHI44_03545) - 658597..660362 (+) 1766 Protein_704 T7SS effector LXG polymorphic toxin -
  MHI44_RS03550 (MHI44_03550) - 660376..660840 (+) 465 WP_268353621.1 SMI1/KNR4 family protein -
  MHI44_RS03555 (MHI44_03555) - 661046..661768 (-) 723 WP_144483135.1 NPP1 family protein -
  MHI44_RS03560 (MHI44_03560) - 661962..662782 (-) 821 Protein_707 N-acetylmuramoyl-L-alanine amidase -
  MHI44_RS03565 (MHI44_03565) - 662827..662967 (-) 141 Protein_708 phage holin family protein -
  MHI44_RS03570 (MHI44_03570) - 662994..663179 (-) 186 Protein_709 phage terminase large subunit -
  MHI44_RS03575 (MHI44_03575) terS 663176..663946 (-) 771 WP_339202891.1 phage terminase small subunit -
  MHI44_RS03580 (MHI44_03580) - 664128..664214 (+) 87 WP_073991391.1 YjcZ family sporulation protein -
  MHI44_RS03585 (MHI44_03585) - 664255..664347 (+) 93 WP_088326573.1 YjcZ family sporulation protein -
  MHI44_RS03590 (MHI44_03590) - 664628..664915 (-) 288 WP_327842653.1 hypothetical protein -
  MHI44_RS03595 (MHI44_03595) - 665316..665738 (-) 423 WP_339202894.1 hypothetical protein -
  MHI44_RS03600 (MHI44_03600) - 665710..666072 (-) 363 WP_339202897.1 hypothetical protein -
  MHI44_RS03605 (MHI44_03605) - 666334..666789 (-) 456 WP_339202900.1 sigma factor-like helix-turn-helix DNA-binding protein -
  MHI44_RS03610 (MHI44_03610) - 666892..667515 (-) 624 WP_268292864.1 hypothetical protein -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=968799 MHI44_RS03500 WP_009967785.1 648974..649384(-) (nucA/comI) [Bacillus sp. FSL K6-1366]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=968799 MHI44_RS03500 WP_009967785.1 648974..649384(-) (nucA/comI) [Bacillus sp. FSL K6-1366]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment