Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHH76_RS16945 Genome accession   NZ_CP150261
Coordinates   3361940..3362080 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. FSL L8-0193     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3356940..3367080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH76_RS16920 (MHH76_16920) - 3357233..3357622 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  MHH76_RS16925 (MHH76_16925) comA 3357639..3358277 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  MHH76_RS16930 (MHH76_16930) comP 3358364..3360679 (-) 2316 WP_020452789.1 ATP-binding protein Regulator
  MHH76_RS16935 (MHH76_16935) comX 3360700..3360870 (-) 171 WP_020452790.1 competence pheromone ComX -
  MHH76_RS16940 (MHH76_16940) - 3360842..3361753 (-) 912 WP_035337591.1 polyprenyl synthetase family protein -
  MHH76_RS16945 (MHH76_16945) degQ 3361940..3362080 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  MHH76_RS16950 (MHH76_16950) - 3362566..3362913 (+) 348 WP_223254849.1 hypothetical protein -
  MHH76_RS16955 (MHH76_16955) - 3362956..3364176 (-) 1221 WP_035337594.1 HDOD domain-containing protein -
  MHH76_RS16960 (MHH76_16960) - 3364354..3365823 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  MHH76_RS16965 (MHH76_16965) - 3365841..3366392 (-) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  MHH76_RS16970 (MHH76_16970) - 3366578..3366979 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=968550 MHH76_RS16945 WP_003184860.1 3361940..3362080(-) (degQ) [Bacillus sp. FSL L8-0193]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968550 MHH76_RS16945 WP_003184860.1 3361940..3362080(-) (degQ) [Bacillus sp. FSL L8-0193]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment