Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MHH76_RS13260 Genome accession   NZ_CP150261
Coordinates   2672804..2672980 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus sp. FSL L8-0193     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2667804..2677980
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH76_RS13245 (MHH76_13245) gcvT 2668444..2669538 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  MHH76_RS13250 (MHH76_13250) - 2670133..2671812 (+) 1680 WP_020452163.1 SNF2-related protein -
  MHH76_RS13255 (MHH76_13255) - 2671819..2672613 (+) 795 WP_020452164.1 YqhG family protein -
  MHH76_RS13260 (MHH76_13260) sinI 2672804..2672980 (+) 177 WP_020452165.1 anti-repressor SinI family protein Regulator
  MHH76_RS13265 (MHH76_13265) sinR 2673014..2673349 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  MHH76_RS13270 (MHH76_13270) - 2673454..2674248 (-) 795 WP_020452167.1 TasA family protein -
  MHH76_RS13275 (MHH76_13275) - 2674321..2674905 (-) 585 WP_020452168.1 signal peptidase I -
  MHH76_RS13280 (MHH76_13280) tapA 2674902..2675630 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  MHH76_RS13285 (MHH76_13285) - 2675908..2676228 (+) 321 WP_020452170.1 YqzG/YhdC family protein -
  MHH76_RS13290 (MHH76_13290) - 2676258..2676440 (-) 183 WP_020452171.1 YqzE family protein -
  MHH76_RS13295 (MHH76_13295) comGG 2676529..2676894 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  MHH76_RS13300 (MHH76_13300) comGF 2676906..2677394 (-) 489 WP_236613657.1 competence type IV pilus minor pilin ComGF -
  MHH76_RS13305 (MHH76_13305) comGE 2677303..2677650 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=968533 MHH76_RS13260 WP_020452165.1 2672804..2672980(+) (sinI) [Bacillus sp. FSL L8-0193]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=968533 MHH76_RS13260 WP_020452165.1 2672804..2672980(+) (sinI) [Bacillus sp. FSL L8-0193]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment