Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   MKY56_RS13200 Genome accession   NZ_CP150257
Coordinates   2532781..2533191 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus sp. FSL M8-0054     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2528147..2554468 2532781..2533191 within 0


Gene organization within MGE regions


Location: 2528147..2554468
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY56_RS13175 (MKY56_13175) - 2528314..2529045 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  MKY56_RS13180 (MKY56_13180) cwlH 2529297..2530049 (-) 753 WP_101169548.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  MKY56_RS13185 (MKY56_13185) - 2530236..2530862 (+) 627 WP_015251671.1 TVP38/TMEM64 family protein -
  MKY56_RS13190 (MKY56_13190) gnd 2530881..2531774 (-) 894 WP_015714298.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  MKY56_RS13195 (MKY56_13195) - 2532026..2532748 (+) 723 WP_046381199.1 hypothetical protein -
  MKY56_RS13200 (MKY56_13200) nucA/comI 2532781..2533191 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  MKY56_RS13205 (MKY56_13205) - 2533387..2533731 (+) 345 Protein_2552 sigma-70 family RNA polymerase sigma factor -
  MKY56_RS13210 (MKY56_13210) - 2533877..2534347 (+) 471 WP_033884465.1 MarR family transcriptional regulator -
  MKY56_RS13215 (MKY56_13215) - 2534498..2535910 (+) 1413 WP_163130609.1 MDR family MFS transporter -
  MKY56_RS13220 (MKY56_13220) spoIVCA 2536099..2537559 (-) 1461 WP_250620787.1 site-specific DNA recombinase SpoIVCA -
  MKY56_RS13225 (MKY56_13225) - 2537517..2537695 (-) 179 Protein_2556 hypothetical protein -
  MKY56_RS13230 (MKY56_13230) - 2537940..2538845 (-) 906 WP_163130820.1 LysR family transcriptional regulator -
  MKY56_RS13235 (MKY56_13235) - 2538976..2540235 (+) 1260 WP_163130603.1 APC family permease -
  MKY56_RS13240 (MKY56_13240) rapE 2540684..2541812 (+) 1129 Protein_2559 response regulator aspartate phosphatase RapE -
  MKY56_RS13245 (MKY56_13245) phrE 2541802..2541936 (+) 135 WP_014114495.1 phosphatase RapE inhibitor PhrE -
  MKY56_RS13250 (MKY56_13250) - 2542570..2543292 (-) 723 WP_119899593.1 NAD(P)-binding domain-containing protein -
  MKY56_RS13255 (MKY56_13255) - 2543518..2543877 (+) 360 WP_049635841.1 winged helix-turn-helix transcriptional regulator -
  MKY56_RS13260 (MKY56_13260) nfsA 2544357..2545097 (+) 741 WP_119899595.1 oxygen-insensitive NADPH nitroreductase -
  MKY56_RS13265 (MKY56_13265) - 2545575..2546702 (-) 1128 WP_038429342.1 Rap family tetratricopeptide repeat protein -
  MKY56_RS13270 (MKY56_13270) - 2546888..2548780 (+) 1893 WP_339249736.1 T7SS effector LXG polymorphic toxin -
  MKY56_RS13275 (MKY56_13275) cdiI 2548802..2549161 (+) 360 WP_040082462.1 ribonuclease toxin immunity protein CdiI -
  MKY56_RS13280 (MKY56_13280) - 2549213..2549548 (+) 336 WP_069322770.1 tRNA-Val4 -
  MKY56_RS13285 (MKY56_13285) - 2549609..2550049 (+) 441 WP_069322771.1 SMI1/KNR4 family protein -
  MKY56_RS13290 (MKY56_13290) - 2550148..2550498 (+) 351 WP_250620785.1 SMI1/KNR4 family protein -
  MKY56_RS13295 (MKY56_13295) - 2550796..2551341 (-) 546 WP_069322772.1 SMI1/KNR4 family protein -
  MKY56_RS13300 (MKY56_13300) - 2551361..2552353 (-) 993 WP_224912955.1 HNH endonuclease signature motif containing protein -
  MKY56_RS13305 (MKY56_13305) - 2552486..2553304 (-) 819 WP_163130597.1 N-acetylmuramoyl-L-alanine amidase -
  MKY56_RS13310 (MKY56_13310) - 2553349..2553489 (-) 141 Protein_2573 phage holin family protein -
  MKY56_RS13315 (MKY56_13315) - 2553516..2553701 (-) 186 Protein_2574 phage terminase large subunit -
  MKY56_RS13320 (MKY56_13320) terS 2553698..2554468 (-) 771 Protein_2575 phage terminase small subunit -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=968242 MKY56_RS13200 WP_009967785.1 2532781..2533191(-) (nucA/comI) [Bacillus sp. FSL M8-0054]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=968242 MKY56_RS13200 WP_009967785.1 2532781..2533191(-) (nucA/comI) [Bacillus sp. FSL M8-0054]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment